Property Summary

NCBI Gene PubMed Count 17
PubMed Score 14.44
PubTator Score 8.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.700 5.9e-04
atypical teratoid / rhabdoid tumor -1.300 7.5e-05
cystic fibrosis -1.100 9.5e-04
ependymoma -1.200 1.0e-02
glioblastoma -1.400 5.1e-06
group 3 medulloblastoma -2.500 1.0e-03
interstitial cystitis -1.300 2.5e-03
intraductal papillary-mucinous adenoma (... 1.300 3.0e-03
lung cancer 1.100 2.6e-02
medulloblastoma, large-cell -2.000 3.9e-05
non-small cell lung cancer 1.169 1.5e-09
osteosarcoma 1.230 6.4e-03
pituitary cancer 1.200 9.5e-04
primitive neuroectodermal tumor -1.100 7.9e-04
spina bifida -1.544 4.9e-02
subependymal giant cell astrocytoma -1.834 3.2e-02

Gene RIF (7)

AA Sequence

MTVRNIASICNMGTNASALEKDIGPEQFPINEHYFGLVNFGNTCYCNSVLQALYFCRPFRENVLAYKAQQ      1 - 70
KKKENLLTCLADLFHSIATQKKKVGVIPPKKFISRLRKENDLFDNYMQQDAHEFLNYLLNTIADILQEEK     71 - 140
KQEKQNGKLKNGNMNEPAENNKPELTWVHEIFQGTLTNETRCLNCETVSSKDEDFLDLSVDVEQNTSITH    141 - 210
CLRDFSNTETLCSEQKYYCETCCSKQEAQKRMRVKKLPMILALHLKRFKYMEQLHRYTKLSYRVVFPLEL    211 - 280
RLFNTSSDAVNLDRMYDLVAVVVHCGSGPNRGHYITIVKSHGFWLLFDDDIVEKIDAQAIEEFYGLTSDI    281 - 350
SKNSESGYILFYQSRE                                                          351 - 366
//

Text Mined References (19)

PMID Year Title