Property Summary

NCBI Gene PubMed Count 126
Grant Count 30
R01 Count 22
Funding $2,678,092.28
PubMed Score 72.76
PubTator Score 39.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
hepatocellular carcinoma 1.100 0.000
pancreatic cancer 1.700 0.002
astrocytic glioma -1.600 0.003
ependymoma -2.200 0.002
oligodendroglioma -1.200 0.030
atypical teratoid / rhabdoid tumor -1.600 0.000
glioblastoma -1.200 0.000
medulloblastoma, large-cell -1.200 0.000
primary pancreatic ductal adenocarcinoma 1.893 0.001
tuberculosis and treatment for 6 months -1.300 0.000
adult high grade glioma -1.100 0.000
pilocytic astrocytoma -1.200 0.000
pancreatic carcinoma 1.100 0.003
lung adenocarcinoma 1.100 0.000
Breast cancer 1.400 0.000

 MGI Term (1)

 GWAS Trait (1)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
422 screening 314 / 0 / 163543 HTS for 14-3-3 protein interaction modulators
711 confirmatory 15 / 2 / 35 14-3-3 protein interaction modulators Dose Response Confirmation

Gene RIF (60)

PMID Text
27102539 Data suggest that miR-181b-3p functions as a metastasis activator by promoting Snail-induced epithelial-mesenchymal transition in breast cancer cells by directly targeting YWHAG.
25384678 Loss of p53 function may result in upregulation of 14-3-3gamma in lung cancers
25224486 Changes for CRMP2, TCP1epsilon, TPM2 and 14-3-3gamma were confirmed in experimental tumors and in a series of 28 human SI-NETs.
25154416 Data show that two isoforms of the 14-3-3 family, 14-3-3epsilon and 14-3-3 gamma, can stabilize Cdt2 independent of each other when overexpressed.
25047048 These results showed that the cell surface expression of TRPM4 channels is mediated by 14-3-3gamma binding.
24947669 Proteomics analysis show that Ser40 of TH protein does not significantly contribute to the binding of 14-3-3gamma, and rather has reduced accessibility in the TH:14-3-3gamma complex.
24870749 High 14-3-3gamma expression was seen in 59.5% of non-small cell lung cancers.
24284060 The normalisation capability of 14-3-3 gamma was superior to traditional LC in quantifying Western blot signals of the platelet AD-biomarker Monoamine Oxidase B of patient versus controls.
24282540 HIV-1 Vpr inhibits the binding of 14-3-3 gamma and AID to Smu and Sgamma1 DNA regions
24269678 Data indicate that 14-3-3 zeta, gamma, epsilon, and tau isoforms but not the sigma protein hydrolyze ATP.
More...

AA Sequence

MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKT      1 - 70
SADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATG     71 - 140
EKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDT    141 - 210
LNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN                                     211 - 247
//

Text Mined References (140)

PMID Year Title
27102539 2016 miR-181b-3p promotes epithelial-mesenchymal transition in breast cancer cells through Snail stabilization by directly targeting YWHAG.
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26047703 2015 Suppression of death-associated protein kinase 2 by interaction with 14-3-3 proteins.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25416956 2014 A proteome-scale map of the human interactome network.
25384678 2015 p53 suppresses 14-3-3? by stimulating proteasome-mediated 14-3-3? protein degradation.
25224486 2015 Mechanisms of local invasion in enteroendocrine tumors: identification of novel candidate cytoskeleton-associated proteins in an experimental mouse model by a proteomic approach and validation in human tumors.
25154416 2014 14-3-3 proteins play a role in the cell cycle by shielding cdt2 from ubiquitin-mediated degradation.
More...