Property Summary

NCBI Gene PubMed Count 139
PubMed Score 78.90
PubTator Score 39.36

Knowledge Summary


No data available


  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.100 1.7e-04
astrocytic glioma -1.600 3.1e-03
Astrocytoma, Pilocytic -1.200 2.7e-07
atypical teratoid / rhabdoid tumor -1.600 2.6e-07
Breast cancer 1.400 7.4e-06
ependymoma -2.200 1.9e-03
glioblastoma -1.200 8.1e-07
hepatocellular carcinoma 1.100 9.4e-05
lung adenocarcinoma 1.100 1.7e-07
medulloblastoma, large-cell -1.200 3.5e-05
oligodendroglioma -1.200 3.0e-02
pancreatic cancer 1.100 2.8e-03
pancreatic carcinoma 1.100 2.8e-03
primary pancreatic ductal adenocarcinoma 1.893 5.3e-04
tuberculosis and treatment for 6 months -1.300 9.1e-05


Accession P61981 O70457 P35214 Q6FH52 Q9UDP2 Q9UN99
Symbols EIEE56


PANTHER Protein Class (1)


5D3E   2B05   3UZD   4E2E   4J6S   4O46  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 MGI Phenotype (1)

Gene RIF (66)

AA Sequence

LNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN                                     211 - 247

Text Mined References (152)

PMID Year Title