Property Summary

NCBI Gene PubMed Count 126
PubMed Score 72.76
PubTator Score 39.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung adenocarcinoma 2714 1.74841372858378E-7
atypical teratoid / rhabdoid tumor 4369 2.59520308065992E-7
pilocytic astrocytoma 3086 2.73545198842636E-7
glioblastoma 5572 8.07026951276942E-7
Breast cancer 3099 7.42686049743966E-6
medulloblastoma, large-cell 6234 3.5426759176695E-5
tuberculosis and treatment for 6 months 686 9.10499457518764E-5
hepatocellular carcinoma 550 9.42371776728341E-5
adult high grade glioma 2148 1.69292865488605E-4
primary pancreatic ductal adenocarcinoma 1271 5.26447131087806E-4
ependymoma 2514 0.00187676833961245
pancreatic cancer 2300 0.00192898210044099
pancreatic carcinoma 567 0.00284814414303143
astrocytic glioma 2241 0.00306378948039977
oligodendroglioma 2849 0.0297097705193202
Disease Target Count Z-score Confidence
Williams-Beuren syndrome 45 3.905 2.0

Expression

  Differential Expression (15)

Disease log2 FC p
hepatocellular carcinoma 1.100 0.000
pancreatic cancer 1.700 0.002
astrocytic glioma -1.600 0.003
ependymoma -2.200 0.002
oligodendroglioma -1.200 0.030
atypical teratoid / rhabdoid tumor -1.600 0.000
glioblastoma -1.200 0.000
medulloblastoma, large-cell -1.200 0.000
primary pancreatic ductal adenocarcinoma 1.893 0.001
tuberculosis and treatment for 6 months -1.300 0.000
adult high grade glioma -1.100 0.000
pilocytic astrocytoma -1.200 0.000
pancreatic carcinoma 1.100 0.003
lung adenocarcinoma 1.100 0.000
Breast cancer 1.400 0.000

Synonym

Accession P61981 O70457 P35214 Q6FH52 Q9UDP2 Q9UN99
Symbols PPP1R170
14-3-3GAMMA

Gene

PANTHER Protein Class (1)

PDB

5D3E   2B05   3UZD   4E2E   4J6S   4O46  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

 MGI Term (1)

 GWAS Trait (1)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
422 screening 314 / 0 / 163543 HTS for 14-3-3 protein interaction modulators
711 confirmatory 15 / 2 / 35 14-3-3 protein interaction modulators Dose Response Confirmation

Gene RIF (58)

PMID Text
27102539 Data suggest that miR-181b-3p functions as a metastasis activator by promoting Snail-induced epithelial-mesenchymal transition in breast cancer cells by directly targeting YWHAG.
25384678 Loss of p53 function may result in upregulation of 14-3-3gamma in lung cancers
25224486 Changes for CRMP2, TCP1epsilon, TPM2 and 14-3-3gamma were confirmed in experimental tumors and in a series of 28 human SI-NETs.
25154416 Data show that two isoforms of the 14-3-3 family, 14-3-3epsilon and 14-3-3 gamma, can stabilize Cdt2 independent of each other when overexpressed.
25047048 These results showed that the cell surface expression of TRPM4 channels is mediated by 14-3-3gamma binding.
24947669 Proteomics analysis show that Ser40 of TH protein does not significantly contribute to the binding of 14-3-3gamma, and rather has reduced accessibility in the TH:14-3-3gamma complex.
24870749 High 14-3-3gamma expression was seen in 59.5% of non-small cell lung cancers.
24284060 The normalisation capability of 14-3-3 gamma was superior to traditional LC in quantifying Western blot signals of the platelet AD-biomarker Monoamine Oxidase B of patient versus controls.
24282540 HIV-1 Vpr inhibits the binding of 14-3-3 gamma and AID to Smu and Sgamma1 DNA regions
24269678 Data indicate that 14-3-3 zeta, gamma, epsilon, and tau isoforms but not the sigma protein hydrolyze ATP.
More...

AA Sequence

MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKT      1 - 70
SADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATG     71 - 140
EKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDT    141 - 210
LNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN                                     211 - 247
//

Text Mined References (140)

PMID Year Title
27102539 2016 miR-181b-3p promotes epithelial-mesenchymal transition in breast cancer cells through Snail stabilization by directly targeting YWHAG.
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26047703 2015 Suppression of death-associated protein kinase 2 by interaction with 14-3-3 proteins.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25416956 2014 A proteome-scale map of the human interactome network.
25384678 2015 p53 suppresses 14-3-3? by stimulating proteasome-mediated 14-3-3? protein degradation.
25224486 2015 Mechanisms of local invasion in enteroendocrine tumors: identification of novel candidate cytoskeleton-associated proteins in an experimental mouse model by a proteomic approach and validation in human tumors.
25154416 2014 14-3-3 proteins play a role in the cell cycle by shielding cdt2 from ubiquitin-mediated degradation.
More...