Property Summary

NCBI Gene PubMed Count 139
PubMed Score 78.90
PubTator Score 39.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.100 1.7e-04
astrocytic glioma -1.600 3.1e-03
Astrocytoma, Pilocytic -1.200 2.7e-07
atypical teratoid / rhabdoid tumor -1.600 2.6e-07
Breast cancer 1.400 7.4e-06
ependymoma -2.200 1.9e-03
glioblastoma -1.200 8.1e-07
hepatocellular carcinoma 1.100 9.4e-05
lung adenocarcinoma 1.100 1.7e-07
medulloblastoma, large-cell -1.200 3.5e-05
oligodendroglioma -1.200 3.0e-02
pancreatic cancer 1.100 2.8e-03
pancreatic carcinoma 1.100 2.8e-03
primary pancreatic ductal adenocarcinoma 1.893 5.3e-04
tuberculosis and treatment for 6 months -1.300 9.1e-05

 MGI Phenotype (1)

Gene RIF (66)

AA Sequence

MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKT      1 - 70
SADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATG     71 - 140
EKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDT    141 - 210
LNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN                                     211 - 247
//

Text Mined References (152)

PMID Year Title