Property Summary

NCBI Gene PubMed Count 179
PubMed Score 291.68
PubTator Score 212.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
AU-KLINE SYNDROME 1 0.0 0.0
Breast Neoplasms 445 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (6)

Disease log2 FC p
acute quadriplegic myopathy 1.099 6.1e-04
Multiple myeloma 1.926 1.8e-04
osteosarcoma -1.246 1.0e-05
ovarian cancer -1.800 1.6e-06
psoriasis -1.100 4.2e-04
Subcutaneous panniculitis-like T-cell ly... 1.600 2.9e-02

 OMIM Phenotype (1)

Protein-protein Interaction (5)

Gene RIF (114)

AA Sequence

METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRT      1 - 70
DYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYKG     71 - 140
SDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIIL    141 - 210
DLISESPIKGRAQPYDPNFYDETYDYGGFTMMFDDRRGRPVGFPMRGRGGFDRMPPGRGGRPMPPSRRDY    211 - 280
DDMSPRRGPPPPPPGRGGRGGSRARNLPLPPPPPPRGGDLMAYDRRGRPGDRYDGMVGFSADETWDSAID    281 - 350
TWSPSEWQMAYEPQGGSGYDYSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGAS    351 - 420
IKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF                               421 - 463
//

Text Mined References (203)

PMID Year Title