Property Summary

NCBI Gene PubMed Count 161
Grant Count 74
R01 Count 61
Funding $5,169,913.55
PubMed Score 270.48
PubTator Score 212.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.926 0.000
psoriasis -1.100 0.000
osteosarcoma -1.246 0.000
acute quadriplegic myopathy 1.099 0.001
Subcutaneous panniculitis-like T-cell ly... 1.600 0.029
ovarian cancer -1.800 0.000

Synonym

Accession P61978 Q07244 Q15671 Q59F98 Q5T6W4 Q60577 Q922Y7 Q96J62 hnRNP K
Symbols AUKS
CSBP
TUNP
HNRPK

Gene

PDB

1J5K   1KHM   1ZZI   1ZZJ   1ZZK  

Gene RIF (104)

PMID Text
26713736 hnRNP K may be a key molecule involved in cell motility in RCC cells
26586566 It describes the identification of heterogeneous nuclear ribonucleoprotein K (hnRNPK) as one of the composite element binding factors(CEBF) that acts as transactivator of PXR promoter.
26530384 The authors identified two new human proteins that interact with Ehrlichia chaffeensis EtpE-C: CD147 and heterogeneous nuclear ribonucleoprotein K (hnRNP-K).
26412324 Data implicate hnRNPK in the development of hematological disorders and suggest hnRNPK acts as a tumor suppressor.
26330540 hnRNP K binds miR-122, a mature liver-specific microRNA required for Hepatitis C virus replication.
26317903 Data show that proto-oncogene protein c-myc is upregulated by sumoylated heterogeneous nuclear ribonucleoprotein K (hnRNP K) at the translational level in Burkitt's lymphoma cells.
26305187 RTVP-1 regulates glioma cell spreading, migration and invasion and that these effects are mediated via interaction with N-WASP and by interfering with the inhibitory effect of hnRNPK on the function of this protein.
26164948 hnRNP K interacts with EV71 5' UTR, which is required for efficient synthesis of viral RNA.[review]
26136337 we investigate the role of hnRNP K in the radioresistance of malignant melanoma cells
25865411 These results indicate that dengue virus type 2 and Junin virus induce hnRNP K cytoplasmic translocation to favor viral multiplication.
More...

AA Sequence

METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRT      1 - 70
DYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYKG     71 - 140
SDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIIL    141 - 210
DLISESPIKGRAQPYDPNFYDETYDYGGFTMMFDDRRGRPVGFPMRGRGGFDRMPPGRGGRPMPPSRRDY    211 - 280
DDMSPRRGPPPPPPGRGGRGGSRARNLPLPPPPPPRGGDLMAYDRRGRPGDRYDGMVGFSADETWDSAID    281 - 350
TWSPSEWQMAYEPQGGSGYDYSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGAS    351 - 420
IKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF                               421 - 463
//

Text Mined References (183)

PMID Year Title
26713736 2015 Cytoplasmic Accumulation of Heterogeneous Nuclear Ribonucleoprotein K Strongly Promotes Tumor Invasion in Renal Cell Carcinoma Cells.
26586566 2015 Identification and interplay of sequence specific DNA binding proteins involved in regulation of human Pregnane and Xenobiotic Receptor gene.
26530384 2015 EtpE Binding to DNase X Induces Ehrlichial Entry via CD147 and hnRNP-K Recruitment, Followed by Mobilization of N-WASP and Actin.
26412324 2015 hnRNP K Is a Haploinsufficient Tumor Suppressor that Regulates Proliferation and Differentiation Programs in Hematologic Malignancies.
26330540 2015 Heterogeneous Ribonucleoprotein K (hnRNP K) Binds miR-122, a Mature Liver-Specific MicroRNA Required for Hepatitis C Virus Replication.
26317903 2015 Bortezomib inhibits Burkitt's lymphoma cell proliferation by downregulating sumoylated hnRNP K and c-Myc expression.
26305187 2015 RTVP-1 regulates glioma cell migration and invasion via interaction with N-WASP and hnRNPK.
26173930 2015 GeneMatcher aids in the identification of a new malformation syndrome with intellectual disability, unique facial dysmorphisms, and skeletal and connective tissue abnormalities caused by de novo variants in HNRNPK.
26164948 2015 [Molecular Mechanism of Action of hnRNP K and RTN3 in the Replication of Enterovirus 71].
26136337 2015 Radiosensitization and downregulation of heterogeneous nuclear ribonucleoprotein K (hnRNP K) upon inhibition of mitogen/extracellular signal-regulated kinase (MEK) in malignant melanoma cells.
More...