Property Summary

NCBI Gene PubMed Count 30
Grant Count 22
R01 Count 14
Funding $3,028,028.42
PubMed Score 404.43
PubTator Score 267.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
Multiple Sclerosis 1.200 0.001

Gene RIF (7)

PMID Text
22880006 Nucleocytoplasmic translocation of NTF2 is regulated in mammalian cells.
21195711 Data suggest actin accumulation in senescent cells is due to the failure of RanGTP restoration with ATP deficiency and NTF2 accumulation, resulting in decreased actin export via Exp6 inactivation.
19404486 NTF2 is a potential mediator of retinal vasculature integrity.
19369352 NTF2 is enriched at the nuclear envelope and interacts with NUP153, When added in excess to the import assay, NUP153C inhibited the nuclear import of IN.
18266911 Results report that NTF2 and Ran control nuclear import of the filamentous actin capping protein CapG.
15522285 A nuclear pore binding site was studied on a mutated NTF2 protein.
9562972 NTF2 is enriched at the nuclear envelope and interacts with NUP153, When added in excess to the import assay, NUP153C inhibited the nuclear import of IN.

AA Sequence

MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITA      1 - 70
QDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG                  71 - 127
//

Text Mined References (33)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24855949 2014 A code for RanGDP binding in ankyrin repeats defines a nuclear import pathway.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22880006 2012 Nuclear-cytoplasmic trafficking of NTF2, the nuclear import receptor for the RanGTPase, is subjected to regulation.
21269460 2011 Initial characterization of the human central proteome.
21195711 2011 Reduction of exportin 6 activity leads to actin accumulation via failure of RanGTP restoration and NTF2 sequestration in the nuclei of senescent cells.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
More...