Property Summary

NCBI Gene PubMed Count 33
PubMed Score 421.56
PubTator Score 267.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
HIV Infections 102 0.0 0.0
Disease Target Count P-value
Multiple Sclerosis 540 8.6e-04
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 3.0
Lipid metabolism disorder 114 0.0 3.0

Expression

  Differential Expression (1)

Disease log2 FC p
Multiple Sclerosis 1.200 8.6e-04

Gene RIF (9)

AA Sequence

MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITA      1 - 70
QDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG                  71 - 127
//

Text Mined References (36)

PMID Year Title