Property Summary

NCBI Gene PubMed Count 39
PubMed Score 14.53
PubTator Score 49.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
active Crohn's disease 1.163 9.9e-03
active ulcerative colitis 2.266 1.3e-02
adult high grade glioma -2.500 6.5e-04
Amyotrophic lateral sclerosis 1.181 1.8e-05
astrocytic glioma -2.300 1.8e-03
atypical teratoid / rhabdoid tumor -3.500 1.3e-06
Breast cancer -1.200 9.1e-05
cystic fibrosis 1.031 7.4e-04
ependymoma -2.500 3.5e-03
glioblastoma -1.200 7.2e-03
group 4 medulloblastoma -2.600 3.6e-04
head and neck cancer -1.400 8.7e-04
intraductal papillary-mucinous adenoma (... 1.200 3.8e-02
intraductal papillary-mucinous carcinoma... 1.700 1.5e-02
intraductal papillary-mucinous neoplasm ... 2.300 6.7e-03
lung cancer 1.800 1.5e-05
medulloblastoma, large-cell -3.600 1.2e-05
oligodendroglioma -2.200 6.4e-03
osteosarcoma 1.778 7.0e-05
ovarian cancer -1.500 1.4e-07
pancreatic cancer 1.100 3.2e-04
Pick disease -1.400 8.1e-03
pituitary cancer -1.900 4.2e-04
primary pancreatic ductal adenocarcinoma 1.742 4.2e-03
progressive supranuclear palsy 1.300 7.2e-03
X-linked cerebral adrenoleukodystrophy 1.300 2.7e-02

Gene RIF (26)

AA Sequence

MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGM      1 - 70
ILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHD     71 - 140
RPTALINGHLNSLQSNPLLPDQKVC                                                 141 - 165
//

Text Mined References (39)

PMID Year Title