Property Summary

NCBI Gene PubMed Count 38
Grant Count 74
R01 Count 46
Funding $9,553,191.08
PubMed Score 13.35
PubTator Score 49.92

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P61968 D3DT23 O00158 O88894
Symbols

Gene

PDB

2L4Z  

Gene RIF (26)

PMID Text
26048572 Lmo4 participates in the regulation of lung epithelial cell proliferation but is not essential for tumor progression.
25310299 LMO4 appears to form a hub in protein-protein interaction networks, linking numerous pathways within cells.
25079073 Clim2, in a complex with LMO4, supports mammary stem cells by directly targeting the Fgfr2 promoter in basal cells to increase its expression
25057208 Existence of a region in the lateral portion of the mammalian cochlea that is competent to make an organ of Corti is demonstrated in the absence of LMO4 function.
23407937 the association of high levels of LMO4 with aggressive neuroblastomas is dependent on LMO4 regulation of cadherin expression and hence, tumor invasiveness
23407556 Low LMO4 mRNA levels were associated with response to erlotinib in non-small-cell lung cancer.
23353824 Data suggest that overexpression of LMO4 may disrupt some of the normal tumour suppressor activities of CtIP, thereby contributing to breast cancer progression.
23291272 oncoprotein HBXIP is able to activate the transcriptional coregulatory protein LMO4 through transcription factor Sp1 in promotion of proliferation of breast cancer cells.
22906635 LMO4 is a direct target of p53 and inhibits p53-mediated proliferative inhibition of breast cancer cells through interacting p53
21362019 LMO4 expression in squamous cell carcinoma of the anterior tongue
More...

AA Sequence

MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGM      1 - 70
ILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHD     71 - 140
RPTALINGHLNSLQSNPLLPDQKVC                                                 141 - 165
//

Text Mined References (38)

PMID Year Title
26048572 2015 The LIM-domain only protein 4 contributes to lung epithelial cell proliferation but is not essential for tumor progression.
25416956 2014 A proteome-scale map of the human interactome network.
25310299 2014 The structure of an LIM-only protein 4 (LMO4) and Deformed epidermal autoregulatory factor-1 (DEAF1) complex reveals a common mode of binding to LMO4.
25079073 2014 The co-factor of LIM domains (CLIM/LDB/NLI) maintains basal mammary epithelial stem cells and promotes breast tumorigenesis.
25057208 2014 LMO4 functions as a negative regulator of sensory organ formation in the mammalian cochlea.
24379077 2014 LIM-domain-only proteins: multifunctional nuclear transcription coregulators that interacts with diverse proteins.
23407937 2013 LMO4 is an essential cofactor in the Snail2-mediated epithelial-to-mesenchymal transition of neuroblastoma and neural crest cells.
23407556 2013 BRCA1, LMO4, and CtIP mRNA expression in erlotinib-treated non-small-cell lung cancer patients with EGFR mutations.
23353824 2013 Structural basis of the interaction of the breast cancer oncogene LMO4 with the tumour suppressor CtIP/RBBP8.
23291272 2013 The oncoprotein HBXIP activates transcriptional coregulatory protein LMO4 via Sp1 to promote proliferation of breast cancer cells.
More...