Property Summary

NCBI Gene PubMed Count 22
Grant Count 2
Funding $162,478.14
PubMed Score 34.72
PubTator Score 14.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma -1.400 0.000
astrocytic glioma -2.000 0.008
ependymoma -2.200 0.010
psoriasis -2.900 0.000
osteosarcoma 1.133 0.001
cystic fibrosis -1.120 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
glioblastoma -1.100 0.017
medulloblastoma -1.200 0.020
medulloblastoma, large-cell -2.500 0.000
adrenocortical carcinoma 1.654 0.000
tuberculosis 1.400 0.000
colon cancer 1.400 0.027
lung cancer 2.000 0.000
adult high grade glioma -1.200 0.031
lung carcinoma 1.100 0.000
Pick disease -1.300 0.000
Gaucher disease type 1 -1.100 0.046

Synonym

Accession P61966 B2R5D8 P82267 Q00382 Q53YA7 Q9BTN4 Q9UDW9
Symbols AP19
EKV3
CLAPS1
MEDNIK
SIGMA1A

Gene

 Grant Application (2)

PDB

4P6Z  

Gene RIF (30)

PMID Text
24843023 Crystal structure indicates that Vpu L66 and V67 embed into the hydrophobic pocket on AP1 sigma 1 to accommodate the canonical dileucine residues, while Vpu E62 forms a salt bridge with R15 of AP1 gamma 1
24843023 Crystal structure indicates that Vpu L66 and V67 embed into the hydrophobic pocket on AP1 sigma 1 to accommodate the canonical dileucine residues, while Vpu E62 forms a salt bridge with R15 of AP1 gamma 1
23678182 Crystal structure indicates that Vpu L66 and V67 embed into the hydrophobic pocket on AP1 sigma 1 to accommodate the canonical dileucine residues, while Vpu E62 forms a salt bridge with R15 of AP1 gamma 1
23423674 We solved the pathogenetic mechanism of MEDNIK syndrome, demonstrating that AP1S1 regulates intracellular copper machinery mediated by copper-pump proteins
23077317 Crystal structure indicates that Vpu L66 and V67 embed into the hydrophobic pocket on AP1 sigma 1 to accommodate the canonical dileucine residues, while Vpu E62 forms a salt bridge with R15 of AP1 gamma 1
23077317 Crystal structure indicates that Vpu L66 and V67 embed into the hydrophobic pocket on AP1 sigma 1 to accommodate the canonical dileucine residues, while Vpu E62 forms a salt bridge with R15 of AP1 gamma 1
22103831 Crystal structure indicates that Vpu L66 and V67 embed into the hydrophobic pocket on AP1 sigma 1 to accommodate the canonical dileucine residues, while Vpu E62 forms a salt bridge with R15 of AP1 gamma 1
21762802 Crystal structure indicates that Vpu L66 and V67 embed into the hydrophobic pocket on AP1 sigma 1 to accommodate the canonical dileucine residues, while Vpu E62 forms a salt bridge with R15 of AP1 gamma 1
21762802 Crystal structure indicates that Vpu L66 and V67 embed into the hydrophobic pocket on AP1 sigma 1 to accommodate the canonical dileucine residues, while Vpu E62 forms a salt bridge with R15 of AP1 gamma 1
20594957 Crystal structure indicates that Vpu L66 and V67 embed into the hydrophobic pocket on AP1 sigma 1 to accommodate the canonical dileucine residues, while Vpu E62 forms a salt bridge with R15 of AP1 gamma 1
More...

AA Sequence

MMRFMLLFSRQGKLRLQKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCA      1 - 70
IEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTSKKSVLKAIEQADL     71 - 140
LQEEDESPRSVLEEMGLA                                                        141 - 158
//

Text Mined References (28)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23423674 2013 MEDNIK syndrome: a novel defect of copper metabolism treatable by zinc acetate therapy.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19057675 2008 Disruption of AP1S1, causing a novel neurocutaneous syndrome, perturbs development of the skin and spinal cord.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
More...