Property Summary

NCBI Gene PubMed Count 22
PubMed Score 35.56
PubTator Score 14.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (18)

Disease log2 FC p
adrenocortical carcinoma 1.445 1.7e-03
adult high grade glioma -1.200 3.1e-02
astrocytic glioma -2.000 7.8e-03
atypical teratoid / rhabdoid tumor -1.800 1.5e-04
colon cancer 1.400 2.7e-02
cystic fibrosis -1.120 1.2e-04
ependymoma -2.200 1.0e-02
Gaucher disease type 1 -1.100 4.6e-02
glioblastoma -1.100 1.7e-02
lung cancer 2.000 3.6e-04
lung carcinoma 1.100 4.8e-30
malignant mesothelioma -1.100 7.3e-05
medulloblastoma -1.200 2.0e-02
medulloblastoma, large-cell -2.500 2.8e-04
osteosarcoma 1.133 6.9e-04
Pick disease -1.300 1.4e-04
psoriasis -2.900 1.4e-05
tuberculosis 1.400 6.8e-08

Protein-protein Interaction (4)

Gene RIF (22)

AA Sequence

MMRFMLLFSRQGKLRLQKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCA      1 - 70
IEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTSKKSVLKAIEQADL     71 - 140
LQEEDESPRSVLEEMGLA                                                        141 - 158
//

Text Mined References (28)

PMID Year Title