Property Summary

Ligand Count 35
NCBI Gene PubMed Count 78
PubMed Score 115.43
PubTator Score 67.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 7.8e-07
glioblastoma 1.300 9.2e-07
group 3 medulloblastoma 1.300 1.2e-02
medulloblastoma, large-cell 1.600 3.6e-05
non-small cell lung cancer 1.184 4.3e-15
ovarian cancer 1.100 6.5e-06
pediatric high grade glioma 1.500 1.1e-05

Gene RIF (43)

AA Sequence

MATEEKKPETEAARAQPTPSSSATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIK      1 - 70
IWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQ     71 - 140
SNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLI    141 - 210
DDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSED    211 - 280
NLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC                    281 - 334
//

Text Mined References (87)

PMID Year Title