Property Summary

NCBI Gene PubMed Count 66
Grant Count 42
R01 Count 35
Funding $3,928,722.15
PubMed Score 100.16
PubTator Score 67.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma 1.500 0.000
group 3 medulloblastoma 1.300 0.012
atypical teratoid / rhabdoid tumor 1.300 0.000
medulloblastoma, large-cell 1.600 0.000
non-small cell lung cancer 1.184 0.000
pediatric high grade glioma 1.500 0.000
ovarian cancer 1.100 0.000

Synonym

Accession P61964 Q91VA5 Q9NWX7 Q9UGP9
Symbols SWD3
BIG-3
CFAP89

Gene

PDB

4Y7R   3UVM   4ERZ   3UVN   4EWR   3UVO   4ES0   3UVL   4ERY   2CNX   2CO0   2G99   2G9A   2GNQ   2H13   2H14   2H68   2H6K   2H6N   2H6Q   2H9L   2H9M   2H9N   2H9P   2O9K   3EG6   3EMH   3MXX   3N0D   3N0E   3P4F   3PSL   3SMR   3UR4   3UVK   4A7J   4CY1   4CY2   4ERQ   4ESG   4GM3   4GM8   4GM9   4GMB   4IA9   4O45   4QL1   5EAL   5EAM   5EAP   5EAR   5SXM  

Gene RIF (36)

PMID Text
26471359 Results identify WDR5 as a key cofactor for N-Myc-regulated transcriptional activation and tumorigenesis and as a novel therapeutic target for MYCN-amplified neuroblastomas.
26383167 Target gene recognition by MYC depends on its interaction with WDR5. This interaction could create an avidity-based chromatin recognition mechanism allowing MYC to select its target genes in response to both genetic and epigenetic determinants. Review.
26355959 WDR5 over-expression is associated with poor breast cancer clinical outcome.
26324722 solution structures of the MLL3 core complex assembled with and without WDR5 by small angle x-ray scattering show similar overall topologies
26167872 Wdr5-MLL interaction in C/EBPA N-terminal leukemia is a promising pharmacological target.
26052702 BIG3 may block the KPNAs (KPNA1, KPNA5, and KPNA6) binding region(s) of PHB2.
25666610 findings prove that the TSP-1/CD47/SIRP-alpha signal axis is important to the evolution of tumor cells in the microenvironment of immunotherapy and identify thrombospondin-1 as a key signal
25656485 we have discovered that WDR5 plays an important role in bladder cancer suggesting that WDR5 is a potential biomarker and a promising target in the treatment of bladder cancer.
24793694 results identify WDR5 as a critical epigenomic integrator of histone phosphorylation and methylation and as a major driver of androgen-dependent prostate cancer cell proliferation
24235145 Data indicate that MLL1 methylates Ash2L in the absence of histone H3, but only when assembled within a complex with WDR5 and RbBP5.
More...

AA Sequence

MATEEKKPETEAARAQPTPSSSATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIK      1 - 70
IWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQ     71 - 140
SNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLI    141 - 210
DDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSED    211 - 280
NLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC                    281 - 334
//

Text Mined References (74)

PMID Year Title
26471359 2015 WDR5 Supports an N-Myc Transcriptional Complex That Drives a Protumorigenic Gene Expression Signature in Neuroblastoma.
26383167 2015 The MYC-WDR5 Nexus and Cancer.
26355959 2015 WDR5 Expression Is Prognostic of Breast Cancer Outcome.
26324722 2015 Unique Role of the WD-40 Repeat Protein 5 (WDR5) Subunit within the Mixed Lineage Leukemia 3 (MLL3) Histone Methyltransferase Complex.
26167872 2015 Pharmacological targeting of the Wdr5-MLL interaction in C/EBP? N-terminal leukemia.
26052702 2015 BIG3 Inhibits the Estrogen-Dependent Nuclear Translocation of PHB2 via Multiple Karyopherin-Alpha Proteins in Breast Cancer Cells.
25666610 2015 WD repeat-containing protein 5 (WDR5) localizes to the midbody and regulates abscission.
25656485 2015 Upregulated WDR5 promotes proliferation, self-renewal and chemoresistance in bladder cancer via mediating H3K4 trimethylation.
25416956 2014 A proteome-scale map of the human interactome network.
24793694 2014 A role for WDR5 in integrating threonine 11 phosphorylation to lysine 4 methylation on histone H3 during androgen signaling and in prostate cancer.
More...