Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.94
PubTator Score 5.29

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P61952 P50152
Symbols GNGT11

Gene

Gene RIF (1)

PMID Text
17092487 Collectively, these results suggest a novel senescence pathway mediated by GNG11 in response to environmental cues.

AA Sequence

MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDKNPFKEKGSC      1 - 70
VIS                                                                        71 - 73
//

Text Mined References (14)

PMID Year Title
23583979 2013 Identification of heart rate-associated loci and their effects on cardiac conduction and rhythm disorders.
17092487 2006 G-protein gamma subunit GNG11 strongly regulates cellular senescence.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15914563 2005 Splenic marginal zone lymphoma: proposal of new diagnostic and prognostic markers identified after tissue and cDNA microarray analysis.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12626323 2003 Glucagon and regulation of glucose metabolism.
12486123 2003 Activation of heterotrimeric G proteins by a high energy phosphate transfer via nucleoside diphosphate kinase (NDPK) B and Gbeta subunits. Complex formation of NDPK B with Gbeta gamma dimers and phosphorylation of His-266 IN Gbeta.
More...