Property Summary

NCBI Gene PubMed Count 15
PubMed Score 25.20
PubTator Score 16.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
acute quadriplegic myopathy 1.835 9.1e-08
adult high grade glioma -1.700 3.5e-05
atypical teratoid / rhabdoid tumor -1.700 5.3e-04
Breast cancer -1.500 2.0e-12
breast carcinoma -1.300 3.1e-26
cystic fibrosis -1.600 5.4e-05
glioblastoma -1.200 4.5e-04
intraductal papillary-mucinous adenoma (... -1.400 1.4e-04
intraductal papillary-mucinous carcinoma... -1.100 4.1e-02
intraductal papillary-mucinous neoplasm ... -2.100 2.2e-04
invasive ductal carcinoma -1.187 4.5e-05
lung cancer -3.900 3.2e-02
medulloblastoma, large-cell 1.100 1.7e-02
ovarian cancer -2.500 7.3e-05
psoriasis -1.200 7.8e-29
subependymal giant cell astrocytoma -1.989 2.6e-02

Gene RIF (3)

AA Sequence

MTKGTSSFGKRRNKTHTLCRRCGSKAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRNTTGTGRMRHLKIV      1 - 70
YRRFRHGFREGTTPKPKRAAVAASSSS                                                71 - 97
//

Text Mined References (25)

PMID Year Title