Property Summary

NCBI Gene PubMed Count 15
PubMed Score 24.71
PubTator Score 16.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 7.76177059266405E-29
breast carcinoma 1614 3.14652909225006E-26
Breast cancer 3099 2.02517223301255E-12
acute quadriplegic myopathy 1157 9.14159200262237E-8
adult high grade glioma 2148 3.48123042179899E-5
cystic fibrosis 1670 5.38097613120576E-5
ovarian cancer 8492 7.30768138858517E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 1.3989245589656E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 2.24094231035603E-4
glioblastoma 5572 4.78607276532564E-4
atypical teratoid / rhabdoid tumor 4369 5.29464742925304E-4
invasive ductal carcinoma 2950 0.00608407078587582
medulloblastoma, large-cell 6234 0.0170145635452205
subependymal giant cell astrocytoma 2287 0.0260676519815294
lung cancer 4473 0.0317303011404545
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0407624185431584
Disease Target Count Z-score Confidence
Alveolar echinococcosis 5 3.204 1.6

Expression

Synonym

Accession P61927 B2R4H2 P02403 Q6IBB4 Q99883
Symbols L37

Gene

PDB

4UG0   4V6X   5AJ0  

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
C. elegans OMA EggNOG
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG
S.cerevisiae OMA Inparanoid

Gene RIF (3)

PMID Text
23874713 RPL37, RPS15 and RPS20 regulate the Mdm2-p53-MdmX network but employ different mechanisms to do so.
20935493 Data report that depletion of L37 leads to cell cycle arrest in a MDM2/L11- and p53-dependent manner.
15485924 Transfection revealed more rpL37 mRNA associated with nonphosphorylatable La A(366) than with La S(366), concomitant with La A(366)-specific shift of a fraction of L37 mRNA off polysomes

AA Sequence

MTKGTSSFGKRRNKTHTLCRRCGSKAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRNTTGTGRMRHLKIV      1 - 70
YRRFRHGFREGTTPKPKRAAVAASSSS                                                71 - 97
//

Text Mined References (24)

PMID Year Title
23874713 2013 Ribosomal proteins RPL37, RPS15 and RPS20 regulate the Mdm2-p53-MdmX network.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20935493 2010 Depletion of ribosomal protein L37 occurs in response to DNA damage and activates p53 through the L11/MDM2 pathway.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
More...