Property Summary

NCBI Gene PubMed Count 21
Grant Count 6
Funding $745,686
PubMed Score 18.47
PubTator Score 11.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma -2.900 0.000
astrocytic glioma -1.800 0.027
glioblastoma -2.800 0.000
ependymoma -1.600 0.000
cystic fibrosis 4.226 0.000
atypical teratoid / rhabdoid tumor -4.000 0.000
medulloblastoma, large-cell -1.700 0.001
hereditary spastic paraplegia -1.313 0.001
lung cancer -2.200 0.001
active Crohn's disease 1.326 0.031
interstitial cystitis -1.200 0.012
pediatric high grade glioma -2.000 0.000
pilocytic astrocytoma -1.500 0.000
subependymal giant cell astrocytoma -2.936 0.031
ulcerative colitis 1.900 0.000
ovarian cancer -1.400 0.000
head and neck cancer -1.300 0.008

Synonym

Accession P61925 P04541 Q6IAV2 PKI-alpha
Symbols PRKACN1

Gene

PDB

3AMA   3AMB   3L9L   3L9M   3L9N   3MVJ   3NX8   3OOG   3OVV   3OWP   3OXT   3P0M   3POO   3VQH   4UJ1   4UJ2   4UJ9   4UJA   4UJB   4WB5   4WB6   4WB7   4WB8   5DH9   1CMK   1JLU   1Q8T   1VEB   1XH4   1XH5   1XH6   1XH7   1XH8   1XH9   1XHA   1YDR   2C1A   2C1B   2F7E   2GNI   2JDS   2JDT   2JDV   2L1L   2UVX   2UVY   2UVZ   2UW0   2UW3   2UW4   2UW5   2UW6   2UW7   2UW8   2VNW   2VNY   2VO0   2VO3   2VO6   2VO7   3WYG   3X2U   3X2V   3X2W   4AXA   4IAC   4IAD   4IAF   4IAI   4IAK   4IAY   4IAZ   4IB0   4IB1   4IB3   4IE9   4IJ9   4O21   4O22   4Z83   4Z84   5BX6   5BX7  

Gene RIF (1)

PMID Text
20451256 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEEDAQRSSTEQSGEAQGE      1 - 70
AAKSES                                                                     71 - 76
//

Text Mined References (22)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21812984 2011 The testis-specific C?2 subunit of PKA is kinetically indistinguishable from the common C?1 subunit of PKA.
20485264 2010 An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1.
20451256 2010 A genome-wide association study of bipolar disorder in Norwegian individuals, followed by replication in Icelandic sample.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12798691 2003 Mutants of protein kinase A that mimic the ATP-binding site of protein kinase B (AKT).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...