Property Summary

NCBI Gene PubMed Count 24
Grant Count 6
R01 Count 4
Funding $541,198.66
PubMed Score 38.80
PubTator Score 13.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.416 0.000
osteosarcoma 1.831 0.000
glioblastoma 1.100 0.004
pancreatic ductal adenocarcinoma liver m... -1.277 0.020
group 3 medulloblastoma 1.200 0.003
ovarian cancer 2.400 0.000

Synonym

Accession P61923 B4DDX8 B4DHZ0 F8VS17 F8VWL5 Q549N6 Q9Y3C3
Symbols COPZ
CGI-120
HSPC181
zeta-COP
zeta1-COP

Gene

PDB

2HF6  

 GWAS Trait (1)

Gene RIF (5)

PMID Text
23125841 Tandem affinity purification and mass spectrometry analysis identify subunit zeta 1 of coatomer protein complex (COPZ1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify subunit zeta 1 of coatomer protein complex (COPZ1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify subunit zeta 1 of coatomer protein complex (COPZ1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify subunit zeta 1 of coatomer protein complex (COPZ1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21746916 The knockdown of COPZ1, but not of COPZ2 encoding isoform coatomer protein complex zeta2, caused Golgi apparatus collapse, blocked autophagy, and induced apoptosis in both proliferating and nondividing tumor cells.

AA Sequence

MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYK      1 - 70
SSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQ     71 - 140
QVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR                                     141 - 177
//

Text Mined References (31)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24026423 2014 A genome- and phenome-wide association study to identify genetic variants influencing platelet count and volume and their pleiotropic effects.
23263863 2013 GWAS of blood cell traits identifies novel associated loci and epistatic interactions in Caucasian and African-American children.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
21746916 2011 Tumor-specific silencing of COPZ2 gene encoding coatomer protein complex subunit ? 2 renders tumor cells dependent on its paralogous gene COPZ1.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19167404 2009 Solution structure of human zeta-COP: direct evidences for structural similarity between COP I and clathrin-adaptor coats.
More...