Property Summary

NCBI Gene PubMed Count 240
Grant Count 235
R01 Count 171
Funding $24,314,635.31
PubMed Score 1015.26
PubTator Score 844.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma -1.200 0.000
psoriasis -2.700 0.000
glioblastoma 1.800 0.001
posterior fossa group A ependymoma 3.100 0.000
cystic fibrosis -2.251 0.000
atypical teratoid / rhabdoid tumor 1.800 0.008
medulloblastoma, large-cell -1.100 0.016
lung cancer 4.800 0.000
Breast cancer 3.700 0.026
lung adenocarcinoma -1.100 0.000
pediatric high grade glioma 2.100 0.000
group 3 medulloblastoma -1.200 0.032
pilocytic astrocytoma 1.200 0.013
Polycystic Ovary Syndrome -1.187 0.032
lung carcinoma -1.700 0.000
non-small cell lung carcinoma -1.300 0.000
ovarian cancer -2.100 0.000

Synonym

Accession P61812 B4DKC5 P08112 Q15579 Q15581 Q4VAV9 TGF-beta-2
Symbols LDS4
G-TSF
TGF-beta2

Gene

PANTHER Protein Class (2)

PDB

1TFG   2TGI   4KXZ  

Gene RIF (193)

PMID Text
26826382 In conclusion, each of the DPP-4 inhibitors may have unique drug-specific effects.
26676103 Human retinal pigment epithelial cells were cultured in the presence or absence of TGF-beta2, and reverse-transcription quantitative PCR was performed to determine the mRNA expression of IDO and Nrf2.
26653761 TGFbeta signaling via both SMAD2/7 and PARD6/SMURF1 pathways plays a role in trophoblast growth and differentiation.
26647778 TGF-beta2 induces epithelial-mesenchymal transition by activating the PI3K/Akt/mTOR signaling pathway in cultured human lens epithelial cells.
26511382 TGF-beta2 induces Grb2 to recruit PI3-K to TGF-RII that activates JNK/AP-1-signaling and augments invasiveness of Theileria-transformed macrophages.
26340918 TGFbeta2 is a key growth promoter of CD44(hi) cells that survived chemotherapy and also is a growth inhibitor of cells that survived hypoxia.
26298390 Our study uncovers the PITX2-induced expression of TGFB1/2/3 as well as INHBA genes (p < 0.01) followed by SMAD2/3-dependent TGF-b signalling pathway in ovarian cancer cells
26088755 elevated TGF-beta1 and TGF-beta2 expression triggers invasion and migration by triple-negative breast cancer cells through the EMT process
26065233 High levels of furin, TNF-alpha and TGF-beta2 may be the reason of proceeding decidualization, placentation, and prevention from abortion, in spite of terminating the fetal life.
26037400 these results revealed no correlation between the normalized expression of TGF-beta2, TGF-betaRI, or TGF-betaRII and EDSS scores
More...

AA Sequence

MHYCVLSAFLILHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEPEEVPPEVISI      1 - 70
YNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSENAIPPTFYRPYFRIVRFDVSAMEKN     71 - 140
ASNLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVHEW    141 - 210
LHHKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGTSTYTSGDQKTIKSTRKKNSGKTPH    211 - 280
LLLMLLPSYRLESQQTNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGAC    281 - 350
PYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS          351 - 414
//

Text Mined References (239)

PMID Year Title
26826382 2016 Linagliptin but not Sitagliptin inhibited transforming growth factor-?2-induced endothelial DPP-4 activity and the endothelial-mesenchymal transition.
26676103 2016 Transforming growth factor-?2 increases the capacity of retinal pigment epithelial cells to induce the generation of regulatory T cells.
26653761 2016 Aberrant TGF? Signaling Contributes to Altered Trophoblast Differentiation in Preeclampsia.
26647778 2016 TGF-?2 induces epithelial-mesenchymal transition in cultured human lens epithelial cells through activation of the PI3K/Akt/mTOR signaling pathway.
26511382 2015 TGF-?2 induces Grb2 to recruit PI3-K to TGF-RII that activates JNK/AP-1-signaling and augments invasiveness of Theileria-transformed macrophages.
26340918 2015 Breast cancer cells respond differentially to modulation of TGF?2 signaling after exposure to chemotherapy or hypoxia.
26298390 2015 Invasion of ovarian cancer cells is induced byPITX2-mediated activation of TGF-? and Activin-A.
26088755 2015 Elevated TGF-?1 and -?2 expression accelerates the epithelial to mesenchymal transition in triple-negative breast cancer cells.
26065233 2015 Distribution of furin, TNF-?, and TGF-?2 in the endometrium of missed abortion and voluntary first trimester termination cases.
26037400 2015 Vitamin D levels in multiple sclerosis patients: Association with TGF-?2, TGF-?RI, and TGF-?RII expression.
More...