Property Summary

NCBI Gene PubMed Count 265
PubMed Score 1378.27
PubTator Score 844.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Aortic aneurysm 38 0.0 4.0

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma -1.200 1.2e-06
adult high grade glioma 1.300 1.2e-02
Astrocytoma, Pilocytic 1.200 1.6e-02
atypical teratoid / rhabdoid tumor 1.800 8.3e-03
Breast cancer 3.100 2.8e-02
cystic fibrosis -2.251 4.9e-05
ependymoma 1.700 4.7e-05
glioblastoma 1.500 1.4e-03
group 3 medulloblastoma -1.200 3.2e-02
lung adenocarcinoma -1.100 6.6e-09
lung cancer 3.100 4.2e-06
lung carcinoma -1.700 1.4e-11
medulloblastoma, large-cell -1.100 1.6e-02
non-small cell lung carcinoma -1.300 1.0e-15
ovarian cancer -2.100 1.8e-04
Polycystic ovary syndrome -1.187 3.2e-02
psoriasis -2.700 1.0e-04

Gene RIF (215)

AA Sequence

MHYCVLSAFLILHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEPEEVPPEVISI      1 - 70
YNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSENAIPPTFYRPYFRIVRFDVSAMEKN     71 - 140
ASNLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVHEW    141 - 210
LHHKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGTSTYTSGDQKTIKSTRKKNSGKTPH    211 - 280
LLLMLLPSYRLESQQTNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGAC    281 - 350
PYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS          351 - 414
//

Text Mined References (263)

PMID Year Title