Property Summary

NCBI Gene PubMed Count 23
PubMed Score 369.70
PubTator Score 57.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
acute myeloid leukemia -1.500 4.3e-02
diabetes mellitus -1.200 1.9e-03
glioblastoma 1.200 2.6e-03
lung cancer 1.900 2.9e-03
Multiple myeloma 2.208 1.6e-04
ovarian cancer -1.400 5.7e-04
Waldenstrons macroglobulinemia 1.592 4.6e-03

Gene RIF (8)

AA Sequence

MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILA      1 - 70
VCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG                                71 - 113
//

Text Mined References (30)

PMID Year Title