Property Summary

NCBI Gene PubMed Count 22
Grant Count 135
R01 Count 80
Funding $19,819,886.22
PubMed Score 357.93
PubTator Score 57.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.592 0.005
Multiple myeloma 2.208 0.000
glioblastoma 1.200 0.003
lung cancer 1.900 0.003
diabetes mellitus -1.200 0.002
acute myeloid leukemia -1.500 0.043
ovarian cancer 3.200 0.000

Gene

PANTHER Protein Class (2)

Gene RIF (7)

PMID Text
21606320 single-nucleotide polymorphisms in DAD1 gene is associated with neuroendocrine tumor.
21509594 DAD1 gene expression is decreased in follicular variant of papillary thyroid carcinoma.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19460752 Knockdown of defender against cell death 1 (DAD1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
18383209 DAD1 protein overexpression is associated with small bowel carcinoid tumors

AA Sequence

MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILA      1 - 70
VCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG                                71 - 113
//

Text Mined References (26)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24068947 2013 Common variants in left/right asymmetry genes and pathways are associated with relative hand skill.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21606320 2011 Genetic associations with sporadic neuroendocrine tumor risk.
21509594 2011 Differential expression of a set of genes in follicular and classic variants of papillary thyroid carcinoma.
21269460 2011 Initial characterization of the human central proteome.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
More...