Property Summary

NCBI Gene PubMed Count 22
PubMed Score 357.93
PubTator Score 57.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 2.18619537630482E-5
Multiple myeloma 1328 1.59905795350199E-4
diabetes mellitus 1663 0.00186190252953391
glioblastoma 5572 0.00261918412967381
lung cancer 4473 0.00292159783916694
Waldenstrons macroglobulinemia 765 0.00458636052209439
acute myeloid leukemia 785 0.0428438086789165

Expression

  Differential Expression (7)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.592 0.005
Multiple myeloma 2.208 0.000
glioblastoma 1.200 0.003
lung cancer 1.900 0.003
diabetes mellitus -1.200 0.002
acute myeloid leukemia -1.500 0.043
ovarian cancer 3.200 0.000

Gene

PANTHER Protein Class (2)

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (7)

PMID Text
21606320 single-nucleotide polymorphisms in DAD1 gene is associated with neuroendocrine tumor.
21509594 DAD1 gene expression is decreased in follicular variant of papillary thyroid carcinoma.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19460752 Knockdown of defender against cell death 1 (DAD1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
18383209 DAD1 protein overexpression is associated with small bowel carcinoid tumors

AA Sequence

MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILA      1 - 70
VCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG                                71 - 113
//

Text Mined References (26)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24068947 2013 Common variants in left/right asymmetry genes and pathways are associated with relative hand skill.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21606320 2011 Genetic associations with sporadic neuroendocrine tumor risk.
21509594 2011 Differential expression of a set of genes in follicular and classic variants of papillary thyroid carcinoma.
21269460 2011 Initial characterization of the human central proteome.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
More...