Property Summary

NCBI Gene PubMed Count 316
Grant Count 635
R01 Count 228
Funding $149,226,813.08
PubMed Score 7603.19
PubTator Score 5675.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (53)

Disease Z-score Confidence
Amyloidosis 68 6.741 3.4
Kidney disease 396 6.272 3.1
Carpal tunnel syndrome 19 5.913 3.0
Cancer 2,346 5.856 2.9
Acquired immunodeficiency syndrome 164 5.279 2.6
Arthropathy 34 4.946 2.5
Anemia 252 4.241 2.1
diabetes mellitus 1,663 4.082 2.0
Hypersensitivity reaction type II diseas... 235  3.883 1.9
Arthritis 248 3.805 1.9
Hypertension 287 3.629 1.8
Hemochromatosis 55 3.595 1.8
Liver disease 219 3.493 1.7
Macroglobulinemia 17 3.472 1.7
Leukopenia 42 3.43 1.7
Oral candidiasis 9 3.365 1.7
Lymphatic system disease 14 3.097 1.5
Peritonitis 37 3.096 1.5
Acute cystitis 37 3.048 1.5
Hyperparathyroidism 43 3.046 1.5
Uveitis 103 3.033 1.5
Ankylosing spondylitis 138 3.005 1.5
Lung disease 132 3.005 1.5
Acute kidney injury 65
Amyloidosis, familial visceral 4
Autoimmune Diseases 33
Bare Lymphocyte Syndrome, Type I 4
Diffuse large B-cell lymphoma 41
Down syndrome 548
Heart Diseases 42
Hypergammaglobulinemia 1
Hypoproteinemia, Hypercatabolic 1
Kidney Diseases 86
Peripheral T-cell lymphoma 24
Prostatic Neoplasms 471
Rheumatoid Arthritis 1,160
Squamous cell carcinoma of esophagus 82
glioblastoma 5,572
interstitial cystitis 2,299
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
juvenile dermatomyositis 1,189
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
osteosarcoma 7,933
ovarian cancer 8,484
pilocytic astrocytoma 3,086
primary Sjogren syndrome 789
psoriasis 6,685
subependymal giant cell astrocytoma 2,287
ulcerative colitis 2,087

Expression

Synonym

Accession P61769 P01884 Q540F8 Q6IAT8 Q9UCK0 Q9UD48 Q9UDF4
Symbols IMD43

Gene

B2M

PDB

1SYS   3BH9   1QR1   3LV3   1EFX   1A1N   1A9B   1A9E   1CG9   1XH3   1ZHK   1ZHL   1ZSD   2AK4   2AXF   2AXG   2CIK   2FYY   2FZ3   2H6P   2NW3   2NX5   3BW9   3BWA   3KWW   3KXF   3LKN   3LKO   3LKP   3LKQ   3LKR   3LKS   3MV7   3MV8   3MV9   3VFS   3VFT   3VFU   3VFV   3VFW   4LNR   4PR5   4PRN   4QRR   1YDP   2D31   2DYP   3BZE   3CDG   3CII   3KYN   3KYO   3BHB   3FQW   3FQX   1EXU   3M17   3M1B   4K71   4N0F   4N0U   5BXF   4HX1   2XPG   3RL1   3RL2   4NO3   4NO5   2CLR   4LHU   5BS0   3MRK   1DE4   1ZT4   2PO6   3HUJ   3SDX   3TZV   3U0P   3VWJ   3VWK   4EN3   4WO4   4WW2   4WWK   3S6C   4GUP   4L4T   4L4V   4LCW   4NQC   4NQD   4NQE   4PJ5   4PJ7   4PJ8   4PJ9   4PJA   4PJB   4PJC   4PJD   4PJE   4PJF   4PJG   4PJH   4PJI   4PJX   5D5M   5D7I   5D7J   5D7L   3VRI   3BGM   4NNX   4NNY   1TVB   1TVH   5EU3   5EU4   5EU6   1HSA   1JGD   1JGE   1K5N   1OF2   1OGT   1UXS   1UXW   1W0V   1W0W   2A83   2BSR   2BSS   2BST   3B3I   3B6S   3BP4   3BP7   3CZF   3D18   3DTX   3HCV   4G8G   4G8I   4G9D   4G9F   5DEF   5DEG   3UTQ   3UTS   3UTT   4WDI   4Z76   4Z77   4Z78   5C0D   5HYJ   3FQN   3FQR   1AKJ   1AO7   1B0G   1B0R   1BD2   1DUY   1DUZ   1EEY   1EEZ   1HHG   1HHH   1HHI   1HHJ   1HHK   1HLA   1I1F   1I1Y   1I4F   1I7R   1I7T   1I7U   1IM3   1JF1   1JHT   1LP9   1OGA   1P7Q   1QEW   1QRN   1QSE   1QSF   1S8D   1S9W   1S9X   1S9Y   1T1W   1T1X   1T1Y   1T1Z   1T20   1T21   1T22   1UR7   2AV1   2AV7   2BNQ   2BNR   2C7U   2F53   2F54   2GIT   2GJ6   2GT9   2GTW   2GTZ   2GUO   2J8U   2JCC   2P5E   2P5W   2PYE   2UWE   2V2W   2V2X   2VLJ   2VLK   2VLL   2VLR   2X4N   2X4O   2X4P   2X4Q   2X4R   2X4S   2X4T   2X4U   2X70   3BH8   3D25   3D39   3D3V   3FQT   3FQU   3FT2   3FT3   3FT4   3GIV   3GJF   3GSN   3GSO   3GSQ   3GSR   3GSU   3GSV   3GSW   3GSX   3H7B   3H9H   3H9S   3HAE   3HLA   3HPJ   3I6G   3I6K   3IXA   3KLA   3MGO   3MGT   3MR9   3MRB   3MRC   3MRD   3MRE   3MRF   3MRG   3MRH   3MRI   3MRJ   3MRL   3MRM   3MRN   3MRO   3MRP   3MRQ   3MRR   3MYJ   3O3A   3O3B   3O3D   3O3E   3O4L   3PWJ   3PWL   3PWN   3PWP   3QDG   3QDJ   3QDM   3QEQ   3QFD   3QFJ   3REW   3TO2   3V5D   3V5H   3V5K   4E5X   4EUP   4FTV   4GKN   4GKS   4I4W   4JFD   4JFE   4JFF   4JFO   4JFP   4JFQ   4K7F   4L29   4L3C   4L3E   4MNQ   4NO0   4NO2   4QOK   4U6X   4U6Y   4UQ3   4WJ5   4WUU   4ZEZ   5C07   5C08   5C09   5C0A   5C0B   5C0C   5C0E   5C0F   5C0G   5C0H   5C0I   5C0J   5D2L   5D2N   5D9S   5DDH   5E9D   5EU5   5HHM   5HHN   5HHO   5HHP   5HHQ   5IRO   1HSB   1TMC   2HLA   4HWZ   4I48   3VCL   4U1H   4U1K   5EO0   5EO1   5BRZ   2RFX   3VH8   3WUW   3X11   3X12   5B38   5B39   1MI5   2ESV   3DXA   3FFC   3HG1   3KPR   3KPS   4JRX   4JRY   4MJI   4PRH   4PRI   4PRP   4X6C   4X6D   3SJV   3D2U   1XR9   1KPR   1KTL   1MHE   3AM8   3BZF   1Q94   1QVO   1X7Q   2HN7   4MJ5   4MJ6   4N8V   4UQ2   3VRJ   3QZW   1A6Z   1A1M   1A1O   1AGB   1AGC   1AGD   1AGE   1AGF   1C16   1CE6   1E27   1E28   1GZP   1GZQ   1IM9   1JNJ   1LDS   1M05   1M6O   1N2R   1ONQ   1PY4   1QLF   1QQD   1R3H   1SYV   1UQS   1VGK   1W72   1XR8   1XZ0   1YPZ   1ZS8   1ZVS   2BCK   2BVO   2BVP   2BVQ   2CII   2D4D   2D4F   2E8D   2F74   2F8O   2H26   2HJK   2HJL   2VB5   2X89   2XKS   2XKU   2YPK   2YPL   2YXF   2Z9T   3BO8   3BVN   3BXN   3C9N   3CIQ   3DBX   3DHJ   3DHM   3DX6   3DX7   3DX8   3EKC   3I6L   3IB4   3JTS   3KPL   3KPM   3KPN   3KPO   3KPP   3KPQ   3L3D   3L3G   3L3I   3L3J   3L3K   3LN4   3LN5   3LOW   3LOZ   3MYZ   3MZT   3NA4   3NFN   3OV6   3OX8   3OXR   3OXS   3QDA   3RWJ   3SKM   3SKO   3SPV   3T8X   3TID   3TIE   3TLR   3TM6   3UPR   3VFM   3VFN   3VFO   3VFP   3VFR   3VXM   3VXN   3VXO   3VXP   3VXR   3VXS   3VXU   3W0W   3W39   3WL9   3WLB   3X13   3X14   4E0K   4E0L   4F7M   4F7P   4F7T   4FXL   4HKJ   4JQV   4JQX   4KDT   4LCY   4M8V   4NQV   4NQX   4NT6   4O2C   4O2E   4O2F   4ONO   4PRA   4PRB   4PRD   4PRE   4QRP   4QRQ   4QRS   4QRT   4QRU   4R9H   4RA3   4RAH   4RMQ   4RMR   4RMS   4RMT   4RMU   4RMV   4RMW   4U1I   4U1J   4U1L   4U1M   4U1N   4U1S   4WU5   4WU7   4X6E   4X6F   4XXC   5C9J   5CFH   5CKA   5CKG   5CS7   5CSB   5CSG   5HGA   5HGB   5HGD   5HGH   5J1A  

Gene RIF (248)

PMID Text
26983758 B2M is a potential tissue biomarker and therapeutic target of borderline and malignant ovarian tumours and the dysregulation of B2M in these tumours may be mediated by the TGF-beta signaling pathway.
26921323 The chaperone crystallin, which is a mild modulator of the lag phase of the variant fibrillogenesis, potently inhibits fibril elongation of the wild-type even once it is absorbed on D76N beta2-microglobulin fibrils.
26800100 BTP and B2M levels are less affected than serum by amputation, and should be considered for future study of GFR estimation
26780548 The results show that, although other factors influence the fibril growth kinetics, a striking difference in the solubility of the proteins is a key determinant of the different amyloidogenicity of human B2M and mouse B2M.
26655720 Data suggest that, in modeling early assembly mechanisms for amyloidogenic beta2-microglobulin (B2M and/or truncated B2M, crosslinked and native), domain-swapped hinge region of B2M is key to both intra-molecular and inter-molecular interactions.
26625805 Serum Beta-2 Microglobulin level is elevated in Chronic Hepatitis C related chronic liver diseases and may be used as a marker for Chronic Hepatitis C disease progression towards cirrhosis and carcinoma.
26406402 Overexpression of B2M are associated with invasion, metastasis of the pancreatic ductal adenocarcinoma.
26278164 beta2M-mediated VEGFR-2/Akt/mTOR phosphorylation and tumor angiogenesis was significantly suppressed by over-expression of DKK-3.
26063798 A competitive mechanism of amyloid fibrillation and amorphous aggregation reproduced the observed aggregation kinetics of beta2-microglobulin.
25982269 Monoclonal antibodies to HLA-E bind epitopes carried by unfolded beta2 m-free heavy chains.
More...

AA Sequence

MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVE      1 - 70
HSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM                          71 - 119
//

Text Mined References (328)

PMID Year Title
26983758 2016 Human epithelial-type ovarian tumour marker beta-2-microglobulin is regulated by the TGF-? signaling pathway.
26921323 2016 Co-fibrillogenesis of Wild-type and D76N ?2-Microglobulin: THE CRUCIAL ROLE OF FIBRILLAR SEEDS.
26800100 2015 Effects of Traumatic Amputation on ?-Trace Protein and ?2-Microglobulin Concentrations in Male Soldiers.
26780548 2016 Comparison of the aggregation of homologous ?2-microglobulin variants reveals protein solubility as a key determinant of amyloid formation.
26655720 2016 Uncovering the Early Assembly Mechanism for Amyloidogenic ?2-Microglobulin Using Cross-linking and Native Mass Spectrometry.
26625805 2015 Serum Beta-2 Microglobulin: a Possible Marker for Disease Progression in Egyptian Patients with Chronic HCV Related Liver Diseases.
26406402 2015 Overexpression of B2M and loss of ALK7 expression are associated with invasion, metastasis, and poor-prognosis of the pancreatic ductal adenocarcinoma.
26278164 2015 Dickkopf-3 (DKK-3) obstructs VEGFR-2/Akt/mTOR signaling cascade by interacting of ?2-microglobulin (?2M) in ovarian tumorigenesis.
26063798 2015 Supersaturation-limited and Unlimited Phase Transitions Compete to Produce the Pathway Complexity in Amyloid Fibrillation.
25982269 2015 Monoclonal antibodies to HLA-E bind epitopes carried by unfolded ?2 m-free heavy chains.
More...