Property Summary

NCBI Gene PubMed Count 80
PubMed Score 221.04
PubTator Score 142.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Epilepsy 792 5.468 2.7
Intellectual disability 1016 4.208 2.1
Disease Target Count Z-score Confidence
Hypomyelinating leukodystrophy 6 26 4.103 2.1

Expression

  Differential Expression (22)

Disease log2 FC p
active Crohn's disease 2.642 1.5e-03
active ulcerative colitis 2.687 6.4e-03
adult high grade glioma -2.500 1.9e-07
astrocytic glioma -1.900 2.0e-03
Astrocytoma, Pilocytic -2.100 4.9e-12
atypical teratoid / rhabdoid tumor -3.700 5.2e-11
colon cancer 2.300 3.6e-02
ductal carcinoma in situ -1.700 1.1e-04
ependymoma -1.800 5.6e-03
glioblastoma -2.300 1.7e-10
intraductal papillary-mucinous adenoma (... -1.700 1.9e-02
invasive ductal carcinoma -1.329 5.7e-04
lung cancer -1.600 9.2e-04
medulloblastoma -1.100 7.6e-03
medulloblastoma, large-cell -1.900 6.4e-06
non-small cell lung cancer -1.236 4.5e-09
oligodendroglioma -1.800 4.2e-15
ovarian cancer -1.600 2.9e-07
Pick disease -1.700 1.1e-02
primitive neuroectodermal tumor -1.500 9.9e-04
psoriasis 1.900 5.1e-05
subependymal giant cell astrocytoma -2.590 2.1e-02

Protein-protein Interaction (1)

Gene RIF (48)

AA Sequence

MAPIGLKAVVGEKIMHDVIKKVKKKGEWKVLVVDQLSMRMLSSCCKMTDIMTEGITIVEDINKRREPLPS      1 - 70
LEAVYLITPSEKSVHSLISDFKDPPTAKYRAAHVFFTDSCPDALFNELVKSRAAKVIKTLTEINIAFLPY     71 - 140
ESQVYSLDSADSFQSFYSPHKAQMKNPILERLAEQIATLCATLKEYPAVRYRGEYKDNALLAQLIQDKLD    141 - 210
AYKADDPTMGEGPDKARSQLLILDRGFDPSSPVLHELTFQAMSYDLLPIENDVYKYETSGIGEARVKEVL    211 - 280
LDEDDDLWIALRHKHIAEVSQEVTRSLKDFSSSKRMNTGEKTTMRDLSQMLKKMPQYQKELSKYSTHLHL    281 - 350
AEDCMKHYQGTVDKLCRVEQDLAMGTDAEGEKIKDPMRAIVPILLDANVSTYDKIRIILLYIFLKNGITE    351 - 420
ENLNKLIQHAQIPPEDSEIITNMAHLGVPIVTDSTLRRRSKPERKERISEQTYQLSRWTPIIKDIMEDTI    421 - 490
EDKLDTKHYPYISTRSSASFSTTAVSARYGHWHKNKAPGEYRSGPRLIIFILGGVSLNEMRCAYEVTQAN    491 - 560
GKWEVLIGSTHILTPQKLLDTLKKLNKTDEEISS                                        561 - 594
//

Text Mined References (88)

PMID Year Title