Property Summary

NCBI Gene PubMed Count 17
PubMed Score 17.04
PubTator Score 10.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung cancer 4740 8.9e-04
ovarian cancer 8520 1.6e-03
Multiple myeloma 1332 3.2e-03
Waldenstrons macroglobulinemia 765 4.4e-03
Breast cancer 3578 2.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer 3.900 2.5e-02
lung cancer 1.600 8.9e-04
Multiple myeloma 2.089 3.2e-03
ovarian cancer -1.400 1.6e-03
Waldenstrons macroglobulinemia 1.739 4.4e-03

Synonym

Accession P61758 B2R8L5 O55228 Q15765 Q5JT81 Q86X96
Symbols PFD3
PFDN3
VBP-1
HIBBJ46

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

Gene RIF (6)

AA Sequence

MAAVKDSCGKGEMATGNGRRLHLGIPEAVFVEDVDSFMKQPGNETADTVLKKLDEQYQKYKFMELNLAQK      1 - 70
KRRLKGQIPEIKQTLEILKYMQKKKESTNSMETRFLLADNLYCKASVPPTDKMCLWLGANVMLEYDIDEA     71 - 140
QALLEKNLSTATKNLDSLEEDLDFLRDQFTTTEVNMARVYNWDVKRRNKDDSTKNKA                 141 - 197
//

Text Mined References (23)

PMID Year Title