Property Summary

NCBI Gene PubMed Count 17
PubMed Score 16.50
PubTator Score 10.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.739 0.004
Multiple myeloma 2.089 0.003
lung cancer 1.600 0.001
Breast cancer 3.900 0.025
ovarian cancer 1.800 0.001

Synonym

Accession P61758 B2R8L5 O55228 Q15765 Q5JT81 Q86X96
Symbols PFD3
PFDN3
VBP-1
HIBBJ46

Gene

PANTHER Protein Class (1)

Gene RIF (6)

PMID Text
23964080 VBP1 acts together with p97 to regulate hMSH4 degradation.
23863879 Systematic yeast two-hybrid screenings identify von Hippel-Lindau binding protein 1 (VBP1) as cellular binding partners of HIV-1 integrase
22190034 Systematic yeast two-hybrid screenings identify von Hippel-Lindau binding protein 1 (VBP1) as cellular binding partners of HIV-1 integrase
19232540 Systematic yeast two-hybrid screenings identify von Hippel-Lindau binding protein 1 (VBP1) as cellular binding partners of HIV-1 integrase
17698809 VBP1 and cullin2/von Hippel-Lindau are required for proper HIV-1 expression at a step between integrase-dependent proviral integration into the host genome and transcription of viral genes
12613020 binds to HIF-1 alpha and regulates the function of HIF-1 alpha

AA Sequence

MAAVKDSCGKGEMATGNGRRLHLGIPEAVFVEDVDSFMKQPGNETADTVLKKLDEQYQKYKFMELNLAQK      1 - 70
KRRLKGQIPEIKQTLEILKYMQKKKESTNSMETRFLLADNLYCKASVPPTDKMCLWLGANVMLEYDIDEA     71 - 140
QALLEKNLSTATKNLDSLEEDLDFLRDQFTTTEVNMARVYNWDVKRRNKDDSTKNKA                 141 - 197
//

Text Mined References (23)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23964080 2013 VBP1 facilitates proteasome and autophagy-mediated degradation of MutS homologue hMSH4.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22190034 2011 Global landscape of HIV-human protein complexes.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17698809 2007 von Hippel Lindau binding protein 1-mediated degradation of integrase affects HIV-1 gene expression at a postintegration step.
More...