Property Summary

NCBI Gene PubMed Count 8
Grant Count 1
R01 Count 1
Funding $66,250
PubMed Score 3.37
PubTator Score 3.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
lung adenocarcinoma -3.400 0.000
lung carcinoma -3.100 0.000
non-small cell lung carcinoma -3.100 0.000
acute myeloid leukemia -2.900 0.018

Synonym

Accession P61647 B0YJ97 B9EH72 Q5VZH4
Symbols SIA8F
SIAT8F
SIAT8-F
ST8SiaVI
ST8SIA-VI

Gene

 Grant Application (1)

Gene RIF (2)

PMID Text
25855199 ST8SIA6 gene is involved in the development of multidrug resistance via PI3K/Akt pathway in chronic myeloid leukemia.
16857734 NK cells consistently expressed mRNA encoding ST8Sia VI, which creates alpha2,8-linked disialic acids on O-linked glycans of glycoproteins and NK cells variably expressed high levels of ST8Sia V mRNA required for GT3 expression.

AA Sequence

MRPGGALLALLASLLLLLLLRLLWCPADAPGRARILVEESREATHGTPAALRTLRSPATAVPRATNSTYL      1 - 70
NEKSLQLTEKCKNLQYGIESFSNKTKGYSENDYLQIITDIQSCPWKRQAEEYANFRAKLASCCDAVQNFV     71 - 140
VSQNNTPVGTNMSYEVESKKEIPIKKNIFHMFPVSQPFVDYPYNQCAVVGNGGILNKSLCGTEIDKSDFV    141 - 210
FRCNLPPTTGDVSKDVGSKTNLVTINPSIITLKYGNLKEKKALFLEDIATYGDAFFLLPAFSFRANTGTS    211 - 280
FKVYYTLEESKARQKVLFFHPKYLKDLALFWRTKGVTAYRLSTGLMITSVAVELCKNVKLYGFWPFSKTV    281 - 350
EDIPVSHHYYDNKLPKHGFHQMPKEYSQILQLHMKGILKLQFSKCEVA                          351 - 398
//

Text Mined References (9)

PMID Year Title
27490539 2016 Upregulation of Human ST8Sia VI (?2,8-Sialyltransferase) Gene Expression by Physcion in SK-N-BE(2)-C Human Neuroblastoma Cells.
25855199 2015 ?-2,8-Sialyltransferase Is Involved in the Development of Multidrug Resistance via PI3K/Akt Pathway in Human Chronic Myeloid Leukemia.
19176441 2009 Genome-wide interrogation of germline genetic variation associated with treatment response in childhood acute lymphoblastic leukemia.
16857734 2006 Probing the cis interactions of the inhibitory receptor Siglec-7 with alpha2,8-disialylated ligands on natural killer cells and other leukocytes using glycan-specific antibodies and by analysis of alpha2,8-sialyltransferase gene expression.
15843597 2005 The animal sialyltransferases and sialyltransferase-related genes: a phylogenetic approach.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11980897 2002 Molecular cloning and expression of a sixth type of alpha 2,8-sialyltransferase (ST8Sia VI) that sialylates O-glycans.