Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.37
PubTator Score 3.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung carcinoma 413 1.50571572222204E-39
lung adenocarcinoma 2714 9.86903948421045E-19
lung carcinoma 2844 2.17390172710596E-15
acute myeloid leukemia 785 0.0180406810071959
Disease Target Count Z-score Confidence
Leukemia 88 0.0 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
lung adenocarcinoma -3.400 0.000
lung carcinoma -3.100 0.000
non-small cell lung carcinoma -3.100 0.000
acute myeloid leukemia -2.900 0.018

Synonym

Accession P61647 B0YJ97 B9EH72 Q5VZH4
Symbols SIA8F
SIAT8F
SIAT8-F
ST8SiaVI
ST8SIA-VI

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG

Gene RIF (2)

PMID Text
25855199 ST8SIA6 gene is involved in the development of multidrug resistance via PI3K/Akt pathway in chronic myeloid leukemia.
16857734 NK cells consistently expressed mRNA encoding ST8Sia VI, which creates alpha2,8-linked disialic acids on O-linked glycans of glycoproteins and NK cells variably expressed high levels of ST8Sia V mRNA required for GT3 expression.

AA Sequence

MRPGGALLALLASLLLLLLLRLLWCPADAPGRARILVEESREATHGTPAALRTLRSPATAVPRATNSTYL      1 - 70
NEKSLQLTEKCKNLQYGIESFSNKTKGYSENDYLQIITDIQSCPWKRQAEEYANFRAKLASCCDAVQNFV     71 - 140
VSQNNTPVGTNMSYEVESKKEIPIKKNIFHMFPVSQPFVDYPYNQCAVVGNGGILNKSLCGTEIDKSDFV    141 - 210
FRCNLPPTTGDVSKDVGSKTNLVTINPSIITLKYGNLKEKKALFLEDIATYGDAFFLLPAFSFRANTGTS    211 - 280
FKVYYTLEESKARQKVLFFHPKYLKDLALFWRTKGVTAYRLSTGLMITSVAVELCKNVKLYGFWPFSKTV    281 - 350
EDIPVSHHYYDNKLPKHGFHQMPKEYSQILQLHMKGILKLQFSKCEVA                          351 - 398
//

Text Mined References (9)

PMID Year Title
27490539 2016 Upregulation of Human ST8Sia VI (?2,8-Sialyltransferase) Gene Expression by Physcion in SK-N-BE(2)-C Human Neuroblastoma Cells.
25855199 2015 ?-2,8-Sialyltransferase Is Involved in the Development of Multidrug Resistance via PI3K/Akt Pathway in Human Chronic Myeloid Leukemia.
19176441 2009 Genome-wide interrogation of germline genetic variation associated with treatment response in childhood acute lymphoblastic leukemia.
16857734 2006 Probing the cis interactions of the inhibitory receptor Siglec-7 with alpha2,8-disialylated ligands on natural killer cells and other leukocytes using glycan-specific antibodies and by analysis of alpha2,8-sialyltransferase gene expression.
15843597 2005 The animal sialyltransferases and sialyltransferase-related genes: a phylogenetic approach.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11980897 2002 Molecular cloning and expression of a sixth type of alpha 2,8-sialyltransferase (ST8Sia VI) that sialylates O-glycans.