Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.44
PubTator Score 3.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
non-small cell lung carcinoma 317 1.5e-39
lung carcinoma 2843 2.2e-15
lung adenocarcinoma 2716 9.0e-15
acute myeloid leukemia 783 1.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Leukemia 104 0.0 2.7

Expression

  Differential Expression (4)

Disease log2 FC p
acute myeloid leukemia -2.900 1.8e-02
lung adenocarcinoma -2.800 9.0e-15
lung carcinoma -3.100 2.2e-15
non-small cell lung carcinoma -3.100 1.5e-39

Gene RIF (2)

AA Sequence

MRPGGALLALLASLLLLLLLRLLWCPADAPGRARILVEESREATHGTPAALRTLRSPATAVPRATNSTYL      1 - 70
NEKSLQLTEKCKNLQYGIESFSNKTKGYSENDYLQIITDIQSCPWKRQAEEYANFRAKLASCCDAVQNFV     71 - 140
VSQNNTPVGTNMSYEVESKKEIPIKKNIFHMFPVSQPFVDYPYNQCAVVGNGGILNKSLCGTEIDKSDFV    141 - 210
FRCNLPPTTGDVSKDVGSKTNLVTINPSIITLKYGNLKEKKALFLEDIATYGDAFFLLPAFSFRANTGTS    211 - 280
FKVYYTLEESKARQKVLFFHPKYLKDLALFWRTKGVTAYRLSTGLMITSVAVELCKNVKLYGFWPFSKTV    281 - 350
EDIPVSHHYYDNKLPKHGFHQMPKEYSQILQLHMKGILKLQFSKCEVA                          351 - 398
//

Text Mined References (9)

PMID Year Title