Property Summary

NCBI Gene PubMed Count 26
PubMed Score 280.20
PubTator Score 189.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Craniofacial Abnormalities 147
Disease Target Count P-value
non-small cell lung cancer 2798 3.4177506364466E-15
medulloblastoma, large-cell 6234 3.98157391340421E-7
tuberculosis and treatment for 3 months 327 7.49373762480288E-7
atypical teratoid / rhabdoid tumor 4369 1.32546471645427E-6
ovarian cancer 8492 2.07202512162167E-6
glioblastoma 5572 6.34567874113275E-5
psoriasis 6685 7.23743885062472E-5
pediatric high grade glioma 2712 1.43790471006226E-4
osteosarcoma 7933 2.10822978976398E-4
group 4 medulloblastoma 1875 2.52577450756427E-4
oligodendroglioma 2849 4.21006754945073E-4
astrocytic glioma 2241 4.49512554569917E-4
ependymoma 2514 4.91521837854816E-4
primitive neuroectodermal tumor 3031 7.78928116294935E-4
pilocytic astrocytoma 3086 8.01577221566311E-4
Multiple myeloma 1328 0.00205464415998808
subependymal giant cell astrocytoma 2287 0.00562776236426292
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00605410172784899
invasive ductal carcinoma 2950 0.00815713791726038
Polycystic Ovary Syndrome 335 0.0107373934848608
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.011072996879275
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0318330361261238

Expression

Synonym

Accession P61619 P38378 P57726 Q5JPF8 Q8N0Z4 Q8N3U3 Q8NC71 Q9BU16 Q9Y2R3 Sec61 alpha-1
Symbols HNFJ4
SEC61
HSEC61
SEC61A

Gene

PANTHER Protein Class (1)

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (13)

PMID Text
26356418 Nuclear envelope associated endosome-mediated transfer depends on the nuclear envelope proteins SUN1 and SUN2, as well as the Sec61 translocon complex.
26085089 BiP facilitates Sec61 channel closure (i.e. limits ER Ca(2+) leakage) via the Sec61 channel with the help of ERj3 and ERj6
24934166 Sec61 complex is calcium permeable, the Sec61 complex is tightly regulated in its equilibrium between the closed and open conformations, or "gated", by ligands, such as signal peptides of the transport substrates
24497544 Cotransin, a substrate-selective Sec61 inhibitor, traps nascent transmembrane domains in the cytosolic vestibule, permitting detailed interrogation of an early pre-integration intermediate.
23125841 Tandem affinity purification and mass spectrometry analysis identify Sec61 alpha 1 subunit (SEC61A1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22796945 BiP limits ER Ca(2+) leakage through the Sec61 complex by binding to the ER lumenal loop 7 of Sec61alpha in the vicinity of tyrosine 344.
22505607 Short secretory proteins appear to be ubiquitously transported across the ER membrane through the Sec61 translocon.
22375059 The human SEC61A1 gene is essential for cell growth and viability.
22190034 Tandem affinity purification and mass spectrometry analysis identify Sec61 alpha 1 subunit (SEC61A1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21987770 The present study indicates that Sec61alpha is a host protein involved in Ebola virus (EBOV) replication, specifically in EBOV genome transcription and replication.
More...

AA Sequence

MAIKFLEVIKPFCVILPEIQKPERKIQFKEKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILA      1 - 70
SNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQSIVYVMTGMYGDP     71 - 140
SEMGAGICLLITIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTVNTGRGMEFE    141 - 210
GAIIALFHLLATRTDKVRALREAFYRQNLPNLMNLIATIFVFAVVIYFQGFRVDLPIKSARYRGQYNTYP    211 - 280
IKLFYTSNIPIILQSALVSNLYVISQMLSARFSGNLLVSLLGTWSDTSSGGPARAYPVGGLCYYLSPPES    281 - 350
FGSVLEDPVHAVVYIVFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTA    351 - 420
AAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQSEVGSMGALLF                  421 - 476
//

Text Mined References (30)

PMID Year Title
27392076 2016 Heterozygous Loss-of-Function SEC61A1 Mutations Cause Autosomal-Dominant Tubulo-Interstitial and Glomerulocystic Kidney Disease with Anemia.
26356418 2015 Nuclear envelope-associated endosomes deliver surface proteins to the nucleus.
26085089 2015 Co-chaperone Specificity in Gating of the Polypeptide Conducting Channel in the Membrane of the Human Endoplasmic Reticulum.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24934166 2014 Protein transport into the human ER and related diseases, Sec61-channelopathies.
24497544 2014 An allosteric Sec61 inhibitor traps nascent transmembrane helices at the lateral gate.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22796945 2012 BiP-mediated closing of the Sec61 channel limits Ca2+ leakage from the ER.
22505607 2012 TRC40 can deliver short secretory proteins to the Sec61 translocon.
22375059 2012 Different effects of Sec61?, Sec62 and Sec63 depletion on transport of polypeptides into the endoplasmic reticulum of mammalian cells.
More...