Tbio | Protein transport protein Sec61 subunit alpha isoform 1 |
Plays a crucial role in the insertion of secretory and membrane polypeptides into the ER. Required for assembly of membrane and secretory proteins. Tightly associated with membrane-bound ribosomes, either directly or through adapter proteins.
The protein encoded by this gene belongs to the SECY/SEC61- alpha family. It appears to play a crucial role in the insertion of secretory and membrane polypeptides into the endoplasmic reticulum. This protein found to be tightly associated with membrane-bound ribosomes, either directly or through adaptor proteins. This gene encodes an alpha subunit of the heteromeric SEC61 complex, which also contains beta and gamma subunits. [provided by RefSeq, Jul 2008]
The protein encoded by this gene belongs to the SECY/SEC61- alpha family. It appears to play a crucial role in the insertion of secretory and membrane polypeptides into the endoplasmic reticulum. This protein found to be tightly associated with membrane-bound ribosomes, either directly or through adaptor proteins. This gene encodes an alpha subunit of the heteromeric SEC61 complex, which also contains beta and gamma subunits. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count |
---|---|
Craniofacial Abnormalities | 147 |
Disease | log2 FC | p |
---|---|---|
Multiple myeloma | 1.113 | 0.002 |
astrocytic glioma | 2.000 | 0.000 |
ependymoma | 2.400 | 0.000 |
oligodendroglioma | 2.400 | 0.000 |
glioblastoma | 3.100 | 0.000 |
osteosarcoma | 1.838 | 0.000 |
group 4 medulloblastoma | 2.400 | 0.000 |
atypical teratoid / rhabdoid tumor | 2.900 | 0.000 |
medulloblastoma, large-cell | 3.000 | 0.000 |
primitive neuroectodermal tumor | 1.200 | 0.001 |
pancreatic ductal adenocarcinoma liver m... | -1.720 | 0.032 |
tuberculosis and treatment for 3 months | -1.100 | 0.000 |
non-small cell lung cancer | 1.600 | 0.000 |
intraductal papillary-mucinous adenoma (... | -1.100 | 0.006 |
intraductal papillary-mucinous carcinoma... | -1.100 | 0.011 |
pediatric high grade glioma | 2.400 | 0.000 |
pilocytic astrocytoma | 1.600 | 0.001 |
subependymal giant cell astrocytoma | 1.474 | 0.006 |
psoriasis | 1.100 | 0.000 |
Polycystic Ovary Syndrome | -1.599 | 0.011 |
invasive ductal carcinoma | 1.200 | 0.008 |
ovarian cancer | 2.200 | 0.000 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
Chicken | OMA Inparanoid |
Anole lizard | OMA Inparanoid |
Xenopus | OMA Inparanoid |
PMID | Text |
---|---|
26356418 | Nuclear envelope associated endosome-mediated transfer depends on the nuclear envelope proteins SUN1 and SUN2, as well as the Sec61 translocon complex. |
26085089 | BiP facilitates Sec61 channel closure (i.e. limits ER Ca(2+) leakage) via the Sec61 channel with the help of ERj3 and ERj6 |
24934166 | Sec61 complex is calcium permeable, the Sec61 complex is tightly regulated in its equilibrium between the closed and open conformations, or "gated", by ligands, such as signal peptides of the transport substrates |
24497544 | Cotransin, a substrate-selective Sec61 inhibitor, traps nascent transmembrane domains in the cytosolic vestibule, permitting detailed interrogation of an early pre-integration intermediate. |
23125841 | Tandem affinity purification and mass spectrometry analysis identify Sec61 alpha 1 subunit (SEC61A1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells |
22796945 | BiP limits ER Ca(2+) leakage through the Sec61 complex by binding to the ER lumenal loop 7 of Sec61alpha in the vicinity of tyrosine 344. |
22505607 | Short secretory proteins appear to be ubiquitously transported across the ER membrane through the Sec61 translocon. |
22375059 | The human SEC61A1 gene is essential for cell growth and viability. |
22190034 | Tandem affinity purification and mass spectrometry analysis identify Sec61 alpha 1 subunit (SEC61A1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells |
21987770 | The present study indicates that Sec61alpha is a host protein involved in Ebola virus (EBOV) replication, specifically in EBOV genome transcription and replication. |
More... |
MAIKFLEVIKPFCVILPEIQKPERKIQFKEKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILA 1 - 70 SNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQSIVYVMTGMYGDP 71 - 140 SEMGAGICLLITIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTVNTGRGMEFE 141 - 210 GAIIALFHLLATRTDKVRALREAFYRQNLPNLMNLIATIFVFAVVIYFQGFRVDLPIKSARYRGQYNTYP 211 - 280 IKLFYTSNIPIILQSALVSNLYVISQMLSARFSGNLLVSLLGTWSDTSSGGPARAYPVGGLCYYLSPPES 281 - 350 FGSVLEDPVHAVVYIVFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTA 351 - 420 AAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQSEVGSMGALLF 421 - 476 //
PMID | Year | Title |
---|---|---|
27392076 | 2016 | Heterozygous Loss-of-Function SEC61A1 Mutations Cause Autosomal-Dominant Tubulo-Interstitial and Glomerulocystic Kidney Disease with Anemia. |
26356418 | 2015 | Nuclear envelope-associated endosomes deliver surface proteins to the nucleus. |
26085089 | 2015 | Co-chaperone Specificity in Gating of the Polypeptide Conducting Channel in the Membrane of the Human Endoplasmic Reticulum. |
25944712 | 2015 | N-terminome analysis of the human mitochondrial proteome. |
24934166 | 2014 | Protein transport into the human ER and related diseases, Sec61-channelopathies. |
24497544 | 2014 | An allosteric Sec61 inhibitor traps nascent transmembrane helices at the lateral gate. |
23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. |
22796945 | 2012 | BiP-mediated closing of the Sec61 channel limits Ca2+ leakage from the ER. |
22505607 | 2012 | TRC40 can deliver short secretory proteins to the Sec61 translocon. |
22375059 | 2012 | Different effects of Sec61?, Sec62 and Sec63 depletion on transport of polypeptides into the endoplasmic reticulum of mammalian cells. |
More... |