Property Summary

NCBI Gene PubMed Count 60
PubMed Score 1027.82
PubTator Score 443.85

Knowledge Summary

Patent

No data available

Expression

Gene RIF (37)

AA Sequence

MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDK      1 - 70
VLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD                                           71 - 102
//

Text Mined References (71)

PMID Year Title