Property Summary

NCBI Gene PubMed Count 56
Grant Count 128
R01 Count 89
Funding $16,278,595.96
PubMed Score 987.95
PubTator Score 443.85

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P61604 O95421 Q04984 Q53X54 Q9UDH0 Hsp10
Symbols EPF
CPN10
GROES
HSP10

Gene

PANTHER Protein Class (2)

PDB

4PJ1  

Gene RIF (32)

PMID Text
26585937 Data indicate that on addition of the heat-shock proteins GroEL-GroES molecular chaperone system, the folding of the nascent chemokine receptor type 5 (CCR5) was significantly enhanced.
26429916 Cpn10 has a role in the spatial regulation of NPAT signaling
25355063 Hsp10 has a role in nuclear localization and lung cells response to cigarette smoke
25075042 Hsp10 and Hsp90 may be involved in large bowel carcinogenesis.
23364796 HIV-1 Tat upregulates the expression of heat shock 10kDa protein 1 (HSPE1; HSP10) in Jurkat cells
21375247 Data show that that in presence of 300 mg/mL Ficoll the thermodynamic stability of each cpn10 monomer increases by over 30%, whereas the interfaces are stabilized by less than 10%.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19903031 HSP10 protein was detected only in oocytes from human preantral follicles, whereas in antral follicles, it was localised in oocytes, granulosa cells, theca cells and stroma cells.
19520060 HSP10 was identified as a new autoantigen in both autoimmune pancreatitis and fulminant type 1 diabetes.
19142874 Results describe a novel function of chaperonin 10 as a general differentiation factor, not limited to erythroid cells, and show how this biological effect is mediated by GSK-3alpha/beta.
More...

AA Sequence

MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDK      1 - 70
VLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD                                           71 - 102
//

Text Mined References (64)

PMID Year Title
26585937 2015 Folding of newly translated membrane protein CCR5 is assisted by the chaperonin GroEL-GroES.
26429916 2015 Interaction of Heat Shock Protein Cpn10 with the Cyclin E/Cdk2 Substrate Nuclear Protein Ataxia-Telangiectasia (NPAT) Is Involved in Regulating Histone Transcription.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25355063 2014 Hsp10 nuclear localization and changes in lung cells response to cigarette smoke suggest novel roles for this chaperonin.
25075042 2014 Comparative analysis of Hsp10 and Hsp90 expression in healthy mucosa and adenocarcinoma of the large bowel.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21908771 2011 The first identification of lysine malonylation substrates and its regulatory enzyme.
More...