Property Summary

NCBI Gene PubMed Count 30
PubMed Score 20.21
PubTator Score 13.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
Breast cancer 3099 7.56007745857629E-20
breast carcinoma 1614 2.89342017128302E-18
lung adenocarcinoma 2714 1.07420123006583E-17
lung carcinoma 2844 7.58303135576497E-17
non-small cell lung cancer 2798 6.2960640620543E-13
oligodendroglioma 2849 5.74503673826577E-10
psoriasis 6685 6.59478619415115E-8
tuberculosis 1563 1.11430366580978E-5
atypical teratoid / rhabdoid tumor 4369 9.14675806951315E-5
ulcerative colitis 2087 6.7730910555612E-4
ovarian cancer 8492 8.24561196458137E-4
group 4 medulloblastoma 1875 0.00143678313597845
medulloblastoma, large-cell 6234 0.00149565529624703
glioblastoma 5572 0.00635480517973569
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00701451447729614
pediatric high grade glioma 2712 0.0115205048154159
Down syndrome 548 0.0130616352902392
astrocytic glioma 2241 0.0179689930999116
invasive ductal carcinoma 2950 0.0210997867014918
Pick disease 1893 0.021210487729072
active Crohn's disease 918 0.0337718192847186
primitive neuroectodermal tumor 3031 0.0397827512717177
Disease Target Count Z-score Confidence
Celiac disease 112 0.0 1.0
substance-related disorder 105 0.0 1.0
Disease Target Count Z-score Confidence
Alcoholic liver cirrhosis 3 3.557 1.8

Expression

  Differential Expression (22)

Disease log2 FC p
astrocytic glioma -1.200 0.018
psoriasis -1.800 0.000
glioblastoma -2.300 0.006
oligodendroglioma -1.200 0.000
group 4 medulloblastoma -2.500 0.001
atypical teratoid / rhabdoid tumor -2.700 0.000
medulloblastoma, large-cell -3.500 0.001
primitive neuroectodermal tumor -1.700 0.040
tuberculosis 1.400 0.000
non-small cell lung cancer -1.207 0.000
intraductal papillary-mucinous adenoma (... -1.100 0.007
active Crohn's disease 1.092 0.034
ulcerative colitis 1.200 0.001
lung adenocarcinoma -1.500 0.000
pediatric high grade glioma -1.700 0.012
invasive ductal carcinoma -1.300 0.021
Breast cancer -3.200 0.000
lung carcinoma 1.700 0.000
breast carcinoma -1.400 0.000
Pick disease -1.800 0.021
ovarian cancer 1.400 0.001
Down syndrome -1.500 0.013

Synonym

Accession P61601 P29554 Q8IYC3 Q9H0W2
Symbols

Gene

  Ortholog (11)

Gene RIF (6)

PMID Text
23156397 It is presumed that NCALD is related to diabetic nephropathy by promoting epithelial mesenchymal transform.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18500817 Studies show that a fold recognition based model of the catalytic domain of ROS-GC1 was built, and neurocalcin delta docking simulations were carried out to define the three-dimensional features of the interacting domains of the two molecules.
17671797 association of the landmark SNP with the progression of diabetic nephropathy in a 8-year prospective study
17671797 Observational study of gene-disease association. (HuGE Navigator)
7852401 The author characterizes the biochemical properties of recombinant bovine neurocalcin delta, whose protein sequence is identical to the human ortholog

AA Sequence

MGKQNSKLRPEVMQDLLESTDFTEHEIQEWYKGFLRDCPSGHLSMEEFKKIYGNFFPYGDASKFAEHVFR      1 - 70
TFDANGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISKAEMLEIVQAIYKMVSSVMKMPE     71 - 140
DESTPEKRTEKIFRQMDTNRDGKLSLEEFIRGAKSDPSIVRLLQCDPSSAGQF                     141 - 193
//

Text Mined References (30)

PMID Year Title
25519916 2014 The EHEC-host interactome reveals novel targets for the translocated intimin receptor.
25416956 2014 A proteome-scale map of the human interactome network.
24939585 2015 Genome-wide association analysis demonstrates the highly polygenic character of age-related hearing impairment.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23156397 2012 [Genetic study for diabetic microvascular complications--recent advances and future perspectives].
21876539 2012 Genome-wide association analysis of coffee drinking suggests association with CYP1A1/CYP1A2 and NRCAM.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20125193 2010 Common genetic variation and performance on standardized cognitive tests.
19342380 2009 Glutamate binding and conformational flexibility of ligand-binding domains are critical early determinants of efficient kainate receptor biogenesis.
More...