Property Summary

NCBI Gene PubMed Count 31
PubMed Score 20.75
PubTator Score 13.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
active Crohn's disease 1.092 3.4e-02
active ulcerative colitis 1.103 3.3e-02
astrocytic glioma -1.200 1.8e-02
atypical teratoid / rhabdoid tumor -2.700 9.1e-05
Breast cancer -3.200 7.6e-20
breast carcinoma -1.400 2.9e-18
Down syndrome -1.500 1.3e-02
glioblastoma -1.200 7.2e-03
group 4 medulloblastoma -2.500 1.4e-03
intraductal papillary-mucinous adenoma (... -1.100 7.0e-03
invasive ductal carcinoma -1.012 1.6e-03
lung adenocarcinoma -1.100 9.5e-14
lung carcinoma 1.700 7.6e-17
medulloblastoma, large-cell -3.500 1.5e-03
non-small cell lung cancer -1.207 6.3e-13
oligodendroglioma -1.200 5.7e-10
ovarian cancer 1.200 1.1e-03
pediatric high grade glioma -1.700 1.2e-02
Pick disease -1.800 2.1e-02
primitive neuroectodermal tumor -1.700 4.0e-02
psoriasis -1.800 6.6e-08
tuberculosis 1.400 1.1e-05

Gene RIF (7)

AA Sequence

MGKQNSKLRPEVMQDLLESTDFTEHEIQEWYKGFLRDCPSGHLSMEEFKKIYGNFFPYGDASKFAEHVFR      1 - 70
TFDANGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISKAEMLEIVQAIYKMVSSVMKMPE     71 - 140
DESTPEKRTEKIFRQMDTNRDGKLSLEEFIRGAKSDPSIVRLLQCDPSSAGQF                     141 - 193
//

Text Mined References (31)

PMID Year Title