Property Summary

NCBI Gene PubMed Count 12
Grant Count 4
R01 Count 4
Funding $414,722.4
PubMed Score 14.37
PubTator Score 5.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
acute quadriplegic myopathy 1.053 0.000
diabetes mellitus -1.200 0.002
invasive ductal carcinoma 1.200 0.012
ovarian cancer 1.600 0.006

Synonym

Accession P61599 A6NHA3 B2R4G4 Q5TFT7 Q9D7H8 Q9H0Y4 Q9NQH6 Q9Y6D2
Symbols NAT3
NAT5
NAT3P
NAT5P
dJ1002M8.1

Gene

PANTHER Protein Class (2)

Gene RIF (3)

PMID Text
22814378 The human NatB complex composed of Naa20 (NAT3) and Naa25 (MDM20) N-terminally acetylates Met-Glu-, Met-Asp-, Met-Asn- and Met-Gln- N-termini, and is important for the structure and function of actomyosin fibers and for proper cellular migration.
18570629 Human N-acetyltransferase complexe NatB consists of human N-acetyltransferase 3 and human MDM20. hNAT3 knockdown results in an increase in G(0)/G(1)-phase cells.
18570629 hNat3 (NAT5) is the catalytic subunit and hMdm20 the auxiliary subunit of the human NatB N-terminal acetyltransferase complex. This ribosome associated complex acetylates nascent Met-Asp/Glu- polypeptides.

AA Sequence

MTTLRAFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEW      1 - 70
HGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSA     71 - 140
SNGEPDEDAYDMRKALSRDTEKKSIIPLPHPVRPEDIE                                    141 - 178
//

Text Mined References (14)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
19660095 2009 A synopsis of eukaryotic Nalpha-terminal acetyltransferases: nomenclature, subunits and substrates.
18570629 2008 Identification of the human N(alpha)-acetyltransferase complex B (hNatB): a complex important for cell-cycle progression.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
More...