Property Summary

NCBI Gene PubMed Count 13
PubMed Score 14.95
PubTator Score 5.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
acute quadriplegic myopathy 1.053 2.6e-06
diabetes mellitus -1.200 1.6e-03
invasive ductal carcinoma 1.200 1.2e-02
ovarian cancer 1.600 6.1e-03

Synonym

Accession P61599 A6NHA3 B2R4G4 Q5TFT7 Q9D7H8 Q9H0Y4 Q9NQH6 Q9Y6D2
Symbols NAT3
NAT5
NAT3P
NAT5P
dJ1002M8.1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MTTLRAFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEW      1 - 70
HGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSA     71 - 140
SNGEPDEDAYDMRKALSRDTEKKSIIPLPHPVRPEDIE                                    141 - 178
//

Text Mined References (15)

PMID Year Title