Property Summary

NCBI Gene PubMed Count 54
PubMed Score 130.25
PubTator Score 52.35

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
breast carcinoma 1614 2.24828982866407E-27
lung carcinoma 2844 2.59309064240144E-13
juvenile dermatomyositis 1189 9.65744958671965E-10
Breast cancer 3099 1.67496206914181E-8
sonic hedgehog group medulloblastoma 1482 4.15552489949572E-8
osteosarcoma 7933 9.30953492344839E-7
Amyotrophic Lateral Sclerosis 432 2.90335834459673E-6
malignant mesothelioma 3163 4.85005555818941E-6
lung adenocarcinoma 2714 7.32353363787294E-6
primary pancreatic ductal adenocarcinoma 1271 7.51573545669662E-5
ovarian cancer 8492 2.43243545981608E-4
pancreatic cancer 2300 2.5178891867973E-4
invasive ductal carcinoma 2950 0.00137190459114862
subependymal giant cell astrocytoma 2287 0.00606121088288355
glioblastoma 5572 0.0132971889314971
atypical teratoid/rhabdoid tumor 1095 0.019118481702017
ulcerative colitis 2087 0.0221232462668397
spina bifida 1064 0.035817889435841
pituitary cancer 1972 0.037272552907874
gastric carcinoma 832 0.0377878286818413
primitive neuroectodermal tumor 3031 0.0466165549029319
Disease Target Count Z-score Confidence
Cancer 2346 3.342 1.7


  Differential Expression (21)


Accession P61587 D3DP95 P52199
Symbols ARHE



2V55   4BG6   1M7B  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

Gene RIF (43)

26976596 RhoA-ROCK-Rnd3 feedback loop determined the local reassembly sites of the actin cortex during membrane blebbing.
26132659 the development and application of a novel data integration methodology reveals novel functions of RND3 in controlling glioma cell migration, invasion, proliferation, angiogenesis and clinical outcome.
26108681 We conclude that downregulation of RND3 is responsible for the enhancement of Notch activity that promotes glioblastoma genesis.
25372032 Rnd3 regulates lung cancer cell proliferation through notch signaling.
24667864 MicroRNA-200b acts as a stimulant for the proliferation of HTFs by targeting p27/kip1 and RND3.
24525741 define RhoE as a Notch1 target that is essential for recruitment of N1IC to promoters of Notch1 target genes, establishing a regulatory feedback loop in Notch1 signaling
24399089 RhoE may participate in human cancer progression and act as a candidate target of p53, and these findings also strongly suggest that RhoE may be a new candidate tumor suppressor and could serve as a potential target in the gene therapy of cancer.
24312338 CXCR4 might be a downstream effector for RhoE
24045951 a mechanism according to which proteasomal degradation of RhoE by Skp2 regulates its protein levels to control cellular proliferation.
23821457 Transfection of pre-miR-200c reduces RhoE expression.

AA Sequence

QRATKRISHMPSRPELSAVATDLRKDKAKSCTVM                                        211 - 244

Text Mined References (54)

PMID Year Title
26976596 2016 A RhoA and Rnd3 cycle regulates actin reassembly during membrane blebbing.
26132659 2015 Inference of Low and High-Grade Glioma Gene Regulatory Networks Delineates the Role of Rnd3 in Establishing Multiple Hallmarks of Cancer.
26108681 2015 Downregulation of RND3/RhoE in glioblastoma patients promotes tumorigenesis through augmentation of notch transcriptional complex activity.
25372032 2014 Rnd3 regulates lung cancer cell proliferation through notch signaling.
24667864 2014 TGF-?1 stimulates human Tenon's capsule fibroblast proliferation by miR-200b and its targeting of p27/kip1 and RND3.
24525741 2014 Small GTPase RhoE/Rnd3 is a critical regulator of Notch1 signaling.
24399089 2014 The Rho GTPase RhoE is a p53-regulated candidate tumor suppressor in cancer cells.
24312338 2013 RhoE promotes metastasis in gastric cancer through a mechanism dependent on enhanced expression of CXCR4.
24045951 2013 The Rho family member RhoE interacts with Skp2 and is degraded at the proteasome during cell cycle progression.
23821457 2014 MicroRNA-200c regulates the sensitivity of chemotherapy of gastric cancer SGC7901/DDP cells by directly targeting RhoE.