Property Summary

NCBI Gene PubMed Count 60
PubMed Score 133.81
PubTator Score 52.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Amyotrophic lateral sclerosis 1.094 2.9e-06
atypical teratoid/rhabdoid tumor 1.100 1.9e-02
Breast cancer -2.100 1.7e-08
breast carcinoma -1.100 2.3e-03
gastric carcinoma 1.200 3.8e-02
glioblastoma 1.600 1.3e-02
group 3 medulloblastoma 1.500 6.4e-03
invasive ductal carcinoma -1.148 1.4e-03
juvenile dermatomyositis 1.265 9.7e-10
lung adenocarcinoma -1.200 7.3e-06
lung carcinoma -2.100 2.6e-13
malignant mesothelioma -1.600 4.9e-06
osteosarcoma 3.309 9.3e-07
ovarian cancer 2.000 2.4e-04
pancreatic cancer 2.000 2.5e-04
pituitary cancer 1.100 3.7e-02
primary pancreatic ductal adenocarcinoma 2.297 7.5e-05
primitive neuroectodermal tumor 1.700 4.7e-02
spina bifida -1.738 3.6e-02
subependymal giant cell astrocytoma 4.137 6.1e-03
ulcerative colitis -1.186 2.2e-02

Gene RIF (49)

AA Sequence

MKERRASQKLSSKSIMDPNQNVKCKIVVVGDSQCGKTALLHVFAKDCFPENYVPTVFENYTASFEIDTQR      1 - 70
IELSLWDTSGSPYYDNVRPLSYPDSDAVLICFDISRPETLDSVLKKWKGEIQEFCPNTKMLLVGCKSDLR     71 - 140
TDVSTLVELSNHRQTPVSYDQGANMAKQIGAATYIECSALQSENSVRDIFHVATLACVNKTNKNVKRNKS    141 - 210
QRATKRISHMPSRPELSAVATDLRKDKAKSCTVM                                        211 - 244
//

Text Mined References (60)

PMID Year Title