Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Synonym

Accession P61582
Symbols PR
ERVK7
Protease
HERV-K102
HERV-KIII
Proteinase
HERV-K(III)

Gene

 GO Component (1)

 Compartment GO Term (0)

Gene RIF (2)

PMID Text
18025878 Replication-competent, particle producing, HERV-K HML-2 Type I retrovirus with foamy-virus-like properties;innate host defence mechanism to bloodborne pathogens with temporary T and B cell responses to Env
16866884 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MNPLEMQRKGPPRRWCLQVYPTAPKRQRPSRTGHDDDGGFVEKKRGKCGEKQERSDCYCVCVERSRHGRL      1 - 70
HFVMC                                                                      71 - 75
//

Text Mined References (8)

PMID Year Title
21542922 2011 A revised nomenclature for transcribed human endogenous retroviral loci.
18025878 2007 The replicative activity of human endogenous retrovirus K102 (HERV-K102) with HIV viremia.
16866884 2006 Neither an intronic CA repeat within the CD48 gene nor the HERV-K18 polymorphisms are associated with type 1 diabetes.
12629516 2003 Quantitation of HERV-K env gene expression and splicing in human breast cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12060620 2002 A novel gene from the human endogenous retrovirus K expressed in transformed cells.
11401426 2001 Transcriptionally active HERV-K genes: identification, isolation, and chromosomal mapping.
10469592 1999 Many human endogenous retrovirus K (HERV-K) proviruses are unique to humans.