Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Synonym

Accession P61582
Symbols PR
ERVK7
Protease
HERV-K102
HERV-KIII
Proteinase
HERV-K(III)

Gene

 GO Component (1)

 Compartment GO Term (0)

Gene RIF (2)

AA Sequence

MNPLEMQRKGPPRRWCLQVYPTAPKRQRPSRTGHDDDGGFVEKKRGKCGEKQERSDCYCVCVERSRHGRL      1 - 70
HFVMC                                                                      71 - 75
//

Text Mined References (8)

PMID Year Title