Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.00
PubTator Score 5.00

Knowledge Summary

Patent

No data available

Synonym

Accession P61580
Symbols PR
Protease
Proteinase

Gene

 GO Component (1)

 Compartment GO Term (0)

Gene RIF (1)

AA Sequence

MNPSEMQRKGPPRRWCLQVYPTAPKRQRPSRTGHDDDGGFVEKKRGKCGEKQERSNCYCVCVERSRHRRL      1 - 70
HFVMC                                                                      71 - 75
//

Text Mined References (15)

PMID Year Title