Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P61579 Q53Z28
Symbols PR
c11_A
Protease
Proteinase

Gene

 GO Function (1)

 GO Component (2)

 GO Process (1)

 Compartment GO Term (0)

AA Sequence

MNPSEMQRKAPPRRRRHRNRAPLTHKMNKMVTSEEQMKLPSTKKAEPPTWAQLKKLTQLATKYLENTKVT      1 - 70
QTPESMLLAALMIVSMVSAGVPNSSEETATIENGP                                        71 - 105
//

Text Mined References (5)

PMID Year Title
21542922 2011 A revised nomenclature for transcribed human endogenous retroviral loci.
18664271 2008 Expression patterns of transcribed human endogenous retrovirus HERV-K(HML-2) loci in human tissues and the need for a HERV Transcriptome Project.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15063128 2004 Human endogenous retrovirus HERV-K(HML-2) proviruses with Rec protein coding capacity and transcriptional activity.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.