Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P61578
Symbols M3.8
c10_A

Gene

 GO Function (1)

 GO Component (2)

 GO Process (1)

 Compartment GO Term (0)

AA Sequence

MNPSEMQRKAPPRRRRHRNRAPSSHKMNKMMMSEEQMKLPSTNKAEPLTWAQLNKLTQLATKCLENTKMT      1 - 70
QTPESMLLAALMIVSTVSAGVPNSSEETVTIENGP                                        71 - 105
//

Text Mined References (5)

PMID Year Title
21542922 2011 A revised nomenclature for transcribed human endogenous retroviral loci.
20005155 2010 The prevalence of human endogenous retroviruses in cerebrospinal fluids from patients with sporadic Creutzfeldt-Jakob disease.
16830071 2006 Tempo and mode of ERV-K evolution in human and chimpanzee genomes.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15063128 2004 Human endogenous retrovirus HERV-K(HML-2) proviruses with Rec protein coding capacity and transcriptional activity.