Knowledge Summary

Patent

No data available

AA Sequence

MNPSEMQRKAPPRRRRHCNRAPLTHKMNKMVTSEEEMKLPSTKKAEPLTWAQLKKLTQLATKCLENTKVT      1 - 70
QTPESMLLAALMIVSMVSAGVTNSSKETATIENGP                                        71 - 105
//

Text Mined References (3)

PMID Year Title
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15063128 2004 Human endogenous retrovirus HERV-K(HML-2) proviruses with Rec protein coding capacity and transcriptional activity.
10469592 1999 Many human endogenous retrovirus K (HERV-K) proviruses are unique to humans.