Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P61575
Symbols PR
ERVK8
envK6
Protease
HERV-K115
Proteinase

Gene

 GO Function (1)

 GO Component (2)

 GO Process (1)

 Compartment GO Term (0)

AA Sequence

MNPSEMQRKAPPRRRRHRNRAPLTHKMNKMVTSEEQMKLPSTKKAEPPTWAQLKKLTQLATKYLENTKVT      1 - 70
QTPESMLLAALMIVSMVSAGVLNSSEETATIENGP                                        71 - 105
//

Text Mined References (4)

PMID Year Title
21542922 2011 A revised nomenclature for transcribed human endogenous retroviral loci.
17077319 2006 Identification of an infectious progenitor for the multiple-copy HERV-K human endogenous retroelements.
15063128 2004 Human endogenous retrovirus HERV-K(HML-2) proviruses with Rec protein coding capacity and transcriptional activity.
11591322 2001 Insertional polymorphisms of full-length endogenous retroviruses in humans.