Knowledge Summary

Patent

No data available

AA Sequence

MNPSEMQRKAPPRRRRHRNRAPLTHKMNKMVTSEEQMKLPSTKKAEPPTWAQLKKLTQLATKYLENTKVT      1 - 70
QTPESMLLAALMIVSMVSYGVPNSSEETATIENGP                                        71 - 105
//

Text Mined References (2)

PMID Year Title