Knowledge Summary

Patent

No data available

AA Sequence

MNPSEMQRKAPPRRRRHRNRAPLTHKMNKMVTSEEQMKLPSTKKAEPPTWAQLKKLTQLATKYLENTKVT      1 - 70
QTPESMLLAALMIVSMVSYGVPNSSEETATIENGP                                        71 - 105
//

Text Mined References (2)

PMID Year Title
15063128 2004 Human endogenous retrovirus HERV-K(HML-2) proviruses with Rec protein coding capacity and transcriptional activity.
11591322 2001 Insertional polymorphisms of full-length endogenous retroviruses in humans.