Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MPGAIDDHCPAQPGEEGTAFNVTMGYKYPPLCLGHATRCIHLETQVWAAYLLERLATGKWGHLVSGLSLC      1 - 70
PLRQMKRGVIGDTPYFQYKPVGKLCPKNFEGPSKTLIWGDCVNSHAVVLKNDSYALVIDWAPKGYLKNTC     71 - 140
SSGGGEFLEATYFISYWEDEDHHPTLHRWFGSFFTLKWEDKDITLHPQGLV                       141 - 191
//

Text Mined References (2)

PMID Year Title
21542922 2011 A revised nomenclature for transcribed human endogenous retroviral loci.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.