Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MVTPVTWMDNPIEVYVNDSEWVPGPTDDRCPAKPEEEGMMINISIGYRYPPICLGTAPGCLMPAVQNWLV      1 - 70
EVPIVSPISRFTYHMVSGMSLRPRVNYLQDFPYQRSLKFRPKGKPCPKEIPKESKNTEVLVWEECVANSA     71 - 140
VILQNNEFGTIIDWAPRGQFYHNCSGQTQSCPSAQVSPAVDSDLTESLDKHKHKKLQSFYPWEWGEKGIS    141 - 210
TPRPKIISPVSGPEHPELWRLTVASHHIRIWSGNQTLETRDRKPFYTVDLNSSLTLPLQSCVKPPYMLVV    211 - 280
GNIVIKPDSQTITCENCRLLTCIDSTFNWQHRILLVRAREGVWILVSMDRPWEASPSVHILTEVLKGVLN    281 - 350
RSKRFIFTLIAVIMGLIAVTATGAVAGVALHSSVQSVNFVNDWQKNSTRLWNSQSSIDQKLANQINDLRQ    351 - 420
TVIWMGDRLMSLEHRFQLQCDWNTSDFCITPQIYNESEHHWDMVRHHLQGREDNLTLDISKLKEQIFEAS    421 - 490
KAHLNLVPGTEAIAGVADGLANLNPVTWVKTIGSTTIINLILILVCLFCLLLVCRCTQQLRRDSDHRERA    491 - 560
MMTMAVLSKRKGGNVGKSKRDQIVTVSV                                              561 - 588
//

Text Mined References (7)

PMID Year Title
22067224 2011 Identification, characterization, and comparative genomic distribution of the HERV-K (HML-2) group of human endogenous retroviruses.
21542922 2011 A revised nomenclature for transcribed human endogenous retroviral loci.
18664271 2008 Expression patterns of transcribed human endogenous retrovirus HERV-K(HML-2) loci in human tissues and the need for a HERV Transcriptome Project.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
12629516 2003 Quantitation of HERV-K env gene expression and splicing in human breast cancer.
11401426 2001 Transcriptionally active HERV-K genes: identification, isolation, and chromosomal mapping.
10469592 1999 Many human endogenous retrovirus K (HERV-K) proviruses are unique to humans.