Property Summary

NCBI Gene PubMed Count 17
PubMed Score 30.75
PubTator Score 7.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Polycystic Ovary Syndrome 335
Disease Target Count P-value
ovarian cancer 8492 1.18578928958734E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00823270721206951
invasive ductal carcinoma 2950 0.0102142255461077
primitive neuroectodermal tumor 3031 0.0198370389175099
colon cancer 1475 0.0211011337591827
group 3 medulloblastoma 2254 0.0229232629652629
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.035694446415507
lung cancer 4473 0.0418039494760215

Expression

Synonym

Accession P61513 P12751 Q6FGF5
Symbols L37A

Gene

PDB

4UG0   4V6X   5AJ0  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid
C. elegans OMA EggNOG
Fruitfly EggNOG Inparanoid

Gene RIF (1)

PMID Text
26362536 HIV-1 Gag interacts with RPL37A as demonstrated by proximity dependent biotinylation proteomics

AA Sequence

MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSCMKTVAGGAWT      1 - 70
YNTTSAVTVKSAIRRLKELKDQ                                                     71 - 92
//

Text Mined References (22)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
More...