Property Summary

NCBI Gene PubMed Count 17
PubMed Score 31.56
PubTator Score 7.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
colon cancer 1.200 2.1e-02
group 3 medulloblastoma 1.300 2.3e-02
intraductal papillary-mucinous carcinoma... 1.100 3.6e-02
intraductal papillary-mucinous neoplasm ... 1.800 8.2e-03
invasive ductal carcinoma 1.100 1.0e-02
lung cancer 1.200 5.0e-02
ovarian cancer -1.700 1.2e-05
primitive neuroectodermal tumor 1.200 2.0e-02

Gene RIF (1)

AA Sequence

MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSCMKTVAGGAWT      1 - 70
YNTTSAVTVKSAIRRLKELKDQ                                                     71 - 92
//

Text Mined References (23)

PMID Year Title