Property Summary

NCBI Gene PubMed Count 17
PubMed Score 30.75
PubTator Score 7.56

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P61513 P12751 Q6FGF5
Symbols L37A

Gene

PDB

4UG0   4V6X   5AJ0  

Gene RIF (1)

PMID Text
26362536 HIV-1 Gag interacts with RPL37A as demonstrated by proximity dependent biotinylation proteomics

AA Sequence

MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSCMKTVAGGAWT      1 - 70
YNTTSAVTVKSAIRRLKELKDQ                                                     71 - 92
//

Text Mined References (22)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
More...