Property Summary

NCBI Gene PubMed Count 44
PubMed Score 87.38
PubTator Score 57.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Gene RIF (12)

AA Sequence

MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVY      1 - 70
NKVHITLSTHECAGLSERDINLASFIEQVAVSMT                                         71 - 104
//

Text Mined References (46)

PMID Year Title