Property Summary

NCBI Gene PubMed Count 34
Grant Count 59
R01 Count 40
Funding $5,710,063.22
PubMed Score 9.11
PubTator Score 5.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 2.000 0.000
diabetes mellitus -1.500 0.001
ovarian cancer 1.200 0.000

Synonym

Accession P61421 P12953 Q02547 V-ATPase subunit d 1
Symbols P39
VATX
VMA6
ATP6D
ATP6DV
VPATPD

Gene

Gene RIF (9)

PMID Text
24631925 The secondary structures of d1 and d2 subunits were highly similar, but the relative stability against thermal stress was higher for d1 than d2.
23125841 Tandem affinity purification and mass spectrometry analysis identify V-type proton ATPase subunit d1 (ATP6V0D1; VPATPD), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify V-type proton ATPase subunit d1 (ATP6V0D1; VPATPD), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify V-type proton ATPase subunit d1 (ATP6V0D1; VPATPD), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify V-type proton ATPase subunit d1 (ATP6V0D1; VPATPD), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19285986 two adjacent enhancers inside the first intron of the neighboring (1.4 kb downstream) ATPase gene (ATP6V0D1) modulate the human AgRP promoter with profound spatiotemporal variation
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia

AA Sequence

MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVI      1 - 70
DDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEA     71 - 140
VNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCP    141 - 210
ILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEG    211 - 280
AGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPI    281 - 350
F//

Text Mined References (37)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24631925 2014 Expression, purification and characterization of human vacuolar-type H(+)-ATPase subunit d1 and d2 in Escherichia coli.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22982048 2012 Lipofuscin is formed independently of macroautophagy and lysosomal activity in stress-induced prematurely senescent human fibroblasts.
21844891 2012 A SNX10/V-ATPase pathway regulates ciliogenesis in vitro and in vivo.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20093472 2010 Requirement of prorenin receptor and vacuolar H+-ATPase-mediated acidification for Wnt signaling.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19285986 2009 Control elements in the neighboring ATPase gene influence spatiotemporal expression of the human agouti-related protein.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18752060 2008 The d subunit plays a central role in human vacuolar H(+)-ATPases.
17897319 2007 Integral and associated lysosomal membrane proteins.
17662945 2007 Coupling of rotation and catalysis in F(1)-ATPase revealed by single-molecule imaging and manipulation.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14597263 2003 Neurotransmitter release: the dark side of the vacuolar-H+ATPase.
14580332 2003 Revised nomenclature for mammalian vacuolar-type H+ -ATPase subunit genes.
12788495 2003 Proton translocation driven by ATP hydrolysis in V-ATPases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12384298 2002 Molecular cloning and characterization of novel tissue-specific isoforms of the human vacuolar H(+)-ATPase C, G and d subunits, and their evaluation in autosomal recessive distal renal tubular acidosis.
11836511 2002 The vacuolar (H+)-ATPases--nature's most versatile proton pumps.
11118322 2000 Structure of the VPATPD gene encoding subunit D of the human vacuolar proton ATPase.
10440860 1999 Animal plasma membrane energization by proton-motive V-ATPases.
10340843 1999 Introduction: V-ATPases 1992-1998.
10224039 1999 Structure and properties of the vacuolar (H+)-ATPases.
10221984 1999 Vacuolar and plasma membrane proton-adenosinetriphosphatases.
9442887 1997 Structure, function and regulation of the vacuolar (H+)-ATPase.
9210392 1997 The vacuolar H+-ATPase: a universal proton pump of eukaryotes.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8250920 1993 Cloning and tissue distribution of subunits C, D, and E of the human vacuolar H(+)-ATPase.
2903164 1988 Cloning of cDNA encoding a 32-kDa protein. An accessory polypeptide of the H+-ATPase from chromaffin granules.
2874839 1986 Receptor-mediated endocytosis: the intracellular journey of transferrin and its receptor.