Property Summary

NCBI Gene PubMed Count 35
PubMed Score 10.47
PubTator Score 5.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 6.8e-05
ovarian cancer 8520 1.3e-04
diabetes mellitus 1728 1.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Argentine hemorrhagic fever 10 4.219 2.1

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus -1.500 1.2e-03
ovarian cancer 1.200 1.3e-04
psoriasis 2.000 6.8e-05

Gene RIF (6)

AA Sequence

MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVI      1 - 70
DDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEA     71 - 140
VNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCP    141 - 210
ILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEG    211 - 280
AGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPI    281 - 350
F//

Text Mined References (38)

PMID Year Title