Property Summary

NCBI Gene PubMed Count 8
Grant Count 4
R01 Count 4
Funding $434,068.67
PubMed Score 22.87
PubTator Score 11.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -2.400 0.000
facioscapulohumeral dystrophy 1.900 0.013

Gene RIF (4)

PMID Text
19453261 Observational study of gene-disease association. (HuGE Navigator)
17951249 Ostn is a naturally occurring ligand of the NPR-C clearance receptor and may act to locally modulate the actions of the natriuretic system in bone by blocking the clearance action of NPR-C, thus locally elevating levels of C-type natriuretic peptide.
17950246 Foxo1 downregulates musclin mRNA expression both in vitro and in vivo, which should explain insulin-mediated upregulation of this gene in muscle cells.
14523025 osteocrin represents a novel, unique vitamin D-regulated bone-specific protein that appears to act as a soluble osteoblast regulator

AA Sequence

MLDWRLASAHFILAVTLTLWSSGKVLSVDVTTTEAFDSGVIDVQSTPTVREEKSATDLTAKLLLLDELVS      1 - 70
LENDVIETKKKRSFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSRG            71 - 133
//

Text Mined References (9)

PMID Year Title
26668395 2015 Musclin is an activity-stimulated myokine that enhances physical endurance.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
17951249 2007 Osteocrin is a specific ligand of the natriuretic Peptide clearance receptor that modulates bone growth.
17950246 2007 Foxo1 represses expression of musclin, a skeletal muscle-derived secretory factor.
15923362 2005 Characterization of osteocrin expression in human bone.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15044443 2004 Musclin, a novel skeletal muscle-derived secretory factor.
14523025 2003 Osteocrin, a novel bone-specific secreted protein that modulates the osteoblast phenotype.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.