Property Summary

NCBI Gene PubMed Count 10
PubMed Score 26.60
PubTator Score 11.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 5.9e-15
facioscapulohumeral dystrophy 288 1.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Acromesomelic dysplasia 10 4.042 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
facioscapulohumeral dystrophy 1.900 1.3e-02
psoriasis -2.400 5.9e-15

Gene RIF (6)

AA Sequence

MLDWRLASAHFILAVTLTLWSSGKVLSVDVTTTEAFDSGVIDVQSTPTVREEKSATDLTAKLLLLDELVS      1 - 70
LENDVIETKKKRSFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSRG            71 - 133
//

Text Mined References (11)

PMID Year Title