Property Summary

NCBI Gene PubMed Count 34
PubMed Score 23.85
PubTator Score 17.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma -2.038 2.0e-04
adult high grade glioma -2.100 4.0e-04
aldosterone-producing adenoma -1.228 4.9e-02
astrocytic glioma -1.200 4.2e-02
Astrocytoma, Pilocytic -1.300 3.0e-02
atypical teratoid / rhabdoid tumor -1.600 1.5e-02
ependymoma -4.000 3.6e-02
glioblastoma -1.800 6.7e-04
group 3 medulloblastoma -2.100 1.2e-02
intraductal papillary-mucinous adenoma (... -1.200 3.0e-03
intraductal papillary-mucinous carcinoma... -1.100 7.5e-03
lung carcinoma 1.200 1.7e-09
malignant mesothelioma 1.200 3.0e-06
medulloblastoma, large-cell -2.400 6.7e-05
oligodendroglioma -1.300 3.2e-02
Pick disease -1.700 8.3e-03
pituitary cancer 1.300 2.5e-05
primitive neuroectodermal tumor -2.200 1.5e-03
subependymal giant cell astrocytoma -1.650 2.5e-02

Gene RIF (17)

AA Sequence

MAAAIASSLIRQKRQARESNSDRVSASKRRSSPSKDGRSLCERHVLGVFSKVRFCSGRKRPVRRRPEPQL      1 - 70
KGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDV     71 - 140
FTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYRE    141 - 210
PSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST                                         211 - 243
//

Text Mined References (32)

PMID Year Title