Property Summary

NCBI Gene PubMed Count 44
PubMed Score 12.61
PubTator Score 15.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.200 1.1e-02
Multiple myeloma 1.867 3.9e-05
ovarian cancer 2.800 5.7e-06
Waldenstrons macroglobulinemia 1.272 6.9e-03

 GO Function (1)

 GWAS Trait (1)

Protein-protein Interaction (7)

Gene RIF (4)

AA Sequence

MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEIT      1 - 70
KEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLH     71 - 140
FKIKPI                                                                    141 - 146
//

Text Mined References (52)

PMID Year Title