Property Summary

NCBI Gene PubMed Count 33
Grant Count 179
R01 Count 102
Funding $20,483,863.45
PubMed Score 877.99
PubTator Score 80.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 0.000

Synonym

Accession P61296 B6ECG9 O95300 O95301 P97833 Q494T1
Symbols Hed
dHand
DHAND2
Thing2
bHLHa26

Gene

Gene RIF (20)

PMID Text
26676105 this study is the first to report the association of a HAND2 loss-of-function mutation with an increased vulnerability to tetralogy of Fallot in humans, which provides novel insight into the molecular mechanism underpinning congenital heart disease
26166202 HAND2-mediated proteolysis negatively regulates the function of estrogen receptor alpha.
24745730 suggest that HAND2 plays a key role in the regulation of progestin-induced decidualization of human endometrial stromal cells.
24265601 Increased HAND2 methylation was a feature of premalignant endometrial lesions and was seen to parallel a decrease in RNA and protein levels.
24210200 Reduced protein expression of HAND2 in the myenteric plexus of the aganglionic segment would suggest that HAND2 was involved in the pathogenesis of Hirschsprung disease.
23449628 Overdosage of Hand2 causes limb and heart defects in the human chromosomal disorder partial trisomy distal 4q.
22323723 Expression analyses on both Hand2 conditionally null and hypomorphic backgrounds demonstrate that Hand2 is required for reporter activation in a gene dosage-dependent manner during sympathetic neurogenesis.
21527398 Data suggest Hand2 plays an important role in decidualization; expression of Hand2 is significantly increased in response to prostaglandin E2.
21431856 No evidence of linkage between HAND2 and CL/P was obtained. Levelss of exclusion were obtained with different inheritance models. results did not support HAND2 in CL/P
21350214 Hand2 performs an essential role during transgenic epicardialization, directly impacting epicardial cell differentiation and formation of the coronary vasculature.
More...

AA Sequence

MSLVGGFPHHPVVHHEGYPFAAAAAAAAAAAASRCSHEENPYFHGWLIGHPEMSPPDYSMALSYSPEYAS      1 - 70
GAAGLDHSHYGGVPPGAGPPGLGGPRPVKRRGTANRKERRRTQSINSAFAELRECIPNVPADTKLSKIKT     71 - 140
LRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHV    141 - 210
WALELKQ                                                                   211 - 217
//

Text Mined References (34)

PMID Year Title
26676105 2016 A novel HAND2 loss-of-function mutation responsible for tetralogy of Fallot.
26166202 2015 HAND2-mediated proteolysis negatively regulates the function of estrogen receptor ?.
25416956 2014 A proteome-scale map of the human interactome network.
24745730 2014 Requirement of heart and neural crest derivatives-expressed transcript 2 during decidualization of human endometrial stromal cells in vitro.
24265601 2013 Role of DNA methylation and epigenetic silencing of HAND2 in endometrial cancer development.
24210200 2013 The research on screening differentially expressed genes in Hirschsprung's disease by using Microarray.
24161931 2013 Nfat and miR-25 cooperate to reactivate the transcription factor Hand2 in heart failure.
23449628 2013 Overdosage of Hand2 causes limb and heart defects in the human chromosomal disorder partial trisomy distal 4q.
22323723 2012 A Phox2- and Hand2-dependent Hand1 cis-regulatory element reveals a unique gene dosage requirement for Hand2 during sympathetic neurogenesis.
21527398 2011 Evidence for a conserved function of heart and neural crest derivatives expressed transcript 2 in mouse and human decidualization.
More...