Property Summary

NCBI Gene PubMed Count 35
PubMed Score 926.68
PubTator Score 80.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 8.7e-13

Protein-protein Interaction (3)

Gene RIF (22)

AA Sequence

MSLVGGFPHHPVVHHEGYPFAAAAAAAAAAAASRCSHEENPYFHGWLIGHPEMSPPDYSMALSYSPEYAS      1 - 70
GAAGLDHSHYGGVPPGAGPPGLGGPRPVKRRGTANRKERRRTQSINSAFAELRECIPNVPADTKLSKIKT     71 - 140
LRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHV    141 - 210
WALELKQ                                                                   211 - 217
//

Text Mined References (36)

PMID Year Title