Property Summary

NCBI Gene PubMed Count 98
PubMed Score 83.65
PubTator Score 54.32

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.700 2.0e-08
cutaneous lupus erythematosus 1.100 2.5e-03
glioblastoma 1.700 4.1e-06
group 4 medulloblastoma 1.200 5.9e-03
lung cancer 1.500 8.1e-04
malignant mesothelioma 1.200 3.0e-06
medulloblastoma, large-cell 2.400 5.0e-08
non-small cell lung cancer 1.043 4.6e-15
osteosarcoma -1.389 2.4e-04
ovarian cancer 1.200 5.6e-04
psoriasis 1.400 1.4e-09

Gene RIF (68)

AA Sequence

MASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPI      1 - 70
LLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWV     71 - 140
QLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEID    141 - 210
EKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY                              211 - 254
//

Text Mined References (114)

PMID Year Title