Property Summary

NCBI Gene PubMed Count 93
Grant Count 18
R01 Count 18
Funding $1,365,687.43
PubMed Score 78.91
PubTator Score 54.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
psoriasis 1.400 0.000
cutaneous lupus erythematosus 1.100 0.003
osteosarcoma -1.389 0.000
atypical teratoid / rhabdoid tumor 1.700 0.000
glioblastoma 1.700 0.000
medulloblastoma 1.300 0.000
medulloblastoma, large-cell 2.400 0.000
non-small cell lung cancer 1.043 0.000
lung cancer 1.800 0.000
ovarian cancer 1.400 0.000

Gene RIF (68)

PMID Text
26425691 PA28gamma in OSCC tumor tissues were significantly high expression than those in normal tissues.
26425675 Surrogate Prognostic Biomarkers in OSCC: The Paradigm of PA28gamma Overexpression.
26201457 In a p53-dominated cellular context, pro-apoptotic signaling might be overcome by PA28gamma-mediated caspase inhibition.
25936920 Results show molecular cloning of a novel transcript variant encoding a truncated form of PA28G likely involved in cell cycle regulation and apoptosis.
25908095 REGgamma acts in skin tumorigenesis mediating MAPK/p38 activation of the Wnt/beta-catenin pathway.
25697482 Examination of EC and normal endometrium specimens confirmed the oncogenic role of REGgamma, in that REGgamma was more highly overexpressed in p53-positive specimens than in p53-negative specimens.
25550823 Our results suggest that the high expression of REGgamma might predict metastasis and poor prognosis in breast cancer.
25511742 Our data indicate that miR-7-5p has a critical function through blocking REGgamma in breast cancer cells.
25490392 REGgamma expression is positively correlated with ERalpha status and poor clinical prognosis in ERalpha positive breast cancer patients
25482151 Increased PA28gamma sera levels were prognostic of disease activity in rheumatoid arthritis.
More...

AA Sequence

MASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPI      1 - 70
LLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWV     71 - 140
QLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEID    141 - 210
EKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY                              211 - 254
//

Text Mined References (109)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26425691 2015 Associations between proteasomal activator PA28? and outcome of oral squamous cell carcinoma: Evidence from cohort studies and functional analyses.
26425675 2015 Surrogate Prognostic Biomarkers in OSCC: The Paradigm of PA28? Overexpression.
26201457 2015 Evidence for anti-apoptotic roles of proteasome activator 28? via inhibiting caspase activity.
25936920 2015 A novel transcript variant of proteasome activator 28?: Identification and function in oral cancer cells.
25908095 2015 REG? is critical for skin carcinogenesis by modulating the Wnt/?-catenin pathway.
25697482 2015 Mutant p53 (p53-R248Q) functions as an oncogene in promoting endometrial cancer by up-regulating REG?.
25550823 2014 High expression of REG? is associated with metastasis and poor prognosis of patients with breast cancer.
25511742 2015 miR-7-5p suppresses cell proliferation and induces apoptosis of breast cancer cells mainly by targeting REG?.
25490392 2015 REG? regulates ER? degradation via ubiquitin-proteasome pathway in breast cancer.
More...