Property Summary

NCBI Gene PubMed Count 87
PubMed Score 13272.34
PubTator Score 1988.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
astrocytoma 1493 9.69539489287992E-29
oligodendroglioma 2849 2.52434836114984E-23
posterior fossa group B ependymoma 1530 2.89053501508776E-12
glioblastoma 5572 2.7240236624153E-8
pilocytic astrocytoma 3086 1.66533429068301E-7
atypical teratoid/rhabdoid tumor 1095 3.68635493247326E-7
pediatric high grade glioma 2712 1.8884532922703E-5
sonic hedgehog group medulloblastoma 1482 1.05174196728673E-4
adrenocortical carcinoma 1427 1.91596055065057E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 4.06780601152873E-4
Pick disease 1893 6.74473397211662E-4
fibroadenoma 557 9.71810348724912E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00381604661294738
ovarian cancer 8492 0.0064840819770643
lung cancer 4473 0.00665739518309939
colon cancer 1475 0.00784300159893837
adrenocortical adenoma 134 0.0110869039586589
pancreatic cancer 2300 0.0142894132994987
primary pancreatic ductal adenocarcinoma 1271 0.0163080165800832
intraductal papillary-mucinous adenoma (IPMA) 2956 0.02142076498499
Down syndrome 548 0.0237272383684635
Parkinson's disease 364 0.0309339003684737

Expression

Synonym

Accession P61278 B2R5G3 P01166
Symbols SMST

Gene

SST

PANTHER Protein Class (2)

PDB

1P2W   2MI1  

  Ortholog (10)

 GO Function (1)

Gene RIF (77)

PMID Text
25881116 Results suggest that DNA methylation may be a proximal mechanism for decreased expression of BDNF, SST, and other BDNF- and GABA-related genes with brain aging and, by extension, for brain disorders in which their expression is decreased
25734919 Aberrant methylation inactivates somatostatin and SSTR1 in head and neck squamous cell carcinoma.
25723531 In cancerous colonic mucosa promoter hypermethylation-related SST downregulation may contribute to the uncontrolled cell proliferation.
25406263 Somatostatin and insulin together are critical paracrine mediators of glucose-inhibited glucagon secretion and function by lowering cAMP/PKA signaling with increasing glucose.
25156131 The aim of the study was to provide knowledge on somatostatin and its action on the body, particularly the pancreas - in physiological and pathological conditions--{REVIEW}
24965867 Distribution of peptidergic populations in the human dentate gyrus (somatostatin [SOM-28, SOM-12] and neuropeptide Y [NPY]) during postnatal development.
24602981 No somatostatin promoter hypermethylation was detected in the Alzheimer neocortex.
24415445 Hemostatic effects and safety does not differ significantly between somatostatin and octreotide as adjuvants to endoscopic treatment in patients with acute gastroesophageal variceal bleeding.
23825418 Somatostatin neurons contribute differently to spatial integration.
23312523 Somatostatin interneurons-mediated disinhibition represents an important circuit mechanism for cortical information processing.
More...

AA Sequence

MLSCRLQCALAALSIVLALGCVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEP      1 - 70
EDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC                             71 - 116
//

Text Mined References (89)

PMID Year Title
25881116 2015 Hypermethylation of BDNF and SST Genes in the Orbital Frontal Cortex of Older Individuals: A Putative Mechanism for Declining Gene Expression with Age.
25734919 2015 Aberrant methylation inactivates somatostatin and somatostatin receptor type 1 in head and neck squamous cell carcinoma.
25723531 2015 Promoter hypermethylation-related reduced somatostatin production promotes uncontrolled cell proliferation in colorectal cancer.
25406263 2015 Somatostatin and insulin mediate glucose-inhibited glucagon secretion in the pancreatic ?-cell by lowering cAMP.
25156131 2014 The clinical significance of somatostatin in pancreatic diseases.
24965867 2014 Distribution of peptidergic populations in the human dentate gyrus (somatostatin [SOM-28, SOM-12] and neuropeptide Y [NPY]) during postnatal development.
24602981 2014 Methylation analysis of SST and SSTR4 promoters in the neocortex of Alzheimer's disease patients.
24415445 2014 Lack of difference among terlipressin, somatostatin, and octreotide in the control of acute gastroesophageal variceal hemorrhage.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23825418 2013 Contrast dependence and differential contributions from somatostatin- and parvalbumin-expressing neurons to spatial integration in mouse V1.
More...