Property Summary

NCBI Gene PubMed Count 87
Grant Count 965
R01 Count 561
Funding $122,472,776.82
PubMed Score 13272.34
PubTator Score 1988.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (81)

Disease Z-score Confidence
Acromegaly 40 7.57 3.8
Adenoma 165 6.188 3.1
Pituitary adenoma 35 5.82 2.9
Cancer 2,346 5.693 2.8
Diarrhea 155 5.619 2.8
Hypoglycemia 81 5.46 2.7
diabetes mellitus 1,663 5.409 2.7
Esophageal varix 10 5.358 2.7
Pancreatitis 97 5.351 2.7
Hyperglycemia 120 5.267 2.6
Cushing's syndrome 47 5.129 2.6
Zollinger-Ellison Syndrome 14 4.938 2.5
Hyperinsulinemic hypoglycemia 17 4.929 2.5
Portal hypertension 21 4.926 2.5
Duodenal ulcer 20 4.87 2.4
Hyperinsulinism 63 4.837 2.4
Dumping syndrome 9 4.74 2.4
Varicose veins 15 4.725 2.4
Cholelithiasis 14 4.56 2.3
Gastritis 44 4.306 2.2
Hyperthyroidism 50 4.236 2.1
Liver Cirrhosis 101 4.164 2.1
Epilepsy 346 4.155 2.1
Alzheimer's disease 644 4.129 2.1
Multiple Endocrine Neoplasia Type 1 30 4.097 2.0
Polycystic liver disease 10 4.078 2.0
Dementia 129 4.052 2.0
Steatorrhea 20 3.938 2.0
Hypopituitarism 36 3.906 2.0
Angiodysplasia 5 3.846 1.9
Pancreatic cholera 6 3.765 1.9
Intestinal obstruction 16 3.741 1.9
Nelson syndrome 6 3.645 1.8
Huntington's disease 72 3.635 1.8
Obesity 616 3.626 1.8
Hyperprolactinemia 22 3.5 1.7
Kidney disease 396 3.497 1.7
Short bowel syndrome 16 3.488 1.7
Hypothyroidism 89 3.4 1.7
Irritable bowel syndrome 59 3.382 1.7
Constipation 43 3.363 1.7
Dyspepsia 34 3.336 1.7
Polycystic kidney disease 54 3.298 1.6
Pain agnosia 99 3.294 1.6
Schizophrenia 501 3.289 1.6
Diabetic Retinopathy 53 3.205 1.6
Hypertension 287 3.161 1.6
McCune Albright syndrome 19 3.066 1.5
Hypokalemia 40 3.011 1.5
Phaeochromocytoma 20 3.004 1.5
Barrett Esophagus 16
Down syndrome 548
Endometriosis 535
Esophageal Neoplasms 67
Esophageal and Gastric Varices 1
Multiple Organ Failure 6
Pancreatic Neoplasm 79
Parkinson's disease 364
Pick disease 1,893
Seizures 95
Spontaneous abortion 108
Vipoma 2
adrenocortical adenoma 134
adrenocortical carcinoma 1,427
astrocytoma 1,493
atypical teratoid/rhabdoid tumor 1,095
colon cancer 1,475
fibroadenoma 557
glioblastoma 5,572
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
lung cancer 4,466
oligodendroglioma 2,849
ovarian cancer 8,484
pancreatic cancer 2,300
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
posterior fossa group B ependymoma 1,530
primary pancreatic ductal adenocarcinoma 1,271
sonic hedgehog group medulloblastoma 1,482

Expression

Synonym

Accession P61278 B2R5G3 P01166
Symbols SMST

Gene

SST

PANTHER Protein Class (2)

PDB

1P2W   2MI1  

 GO Function (1)

Gene RIF (77)

PMID Text
25881116 Results suggest that DNA methylation may be a proximal mechanism for decreased expression of BDNF, SST, and other BDNF- and GABA-related genes with brain aging and, by extension, for brain disorders in which their expression is decreased
25734919 Aberrant methylation inactivates somatostatin and SSTR1 in head and neck squamous cell carcinoma.
25723531 In cancerous colonic mucosa promoter hypermethylation-related SST downregulation may contribute to the uncontrolled cell proliferation.
25406263 Somatostatin and insulin together are critical paracrine mediators of glucose-inhibited glucagon secretion and function by lowering cAMP/PKA signaling with increasing glucose.
25156131 The aim of the study was to provide knowledge on somatostatin and its action on the body, particularly the pancreas - in physiological and pathological conditions--{REVIEW}
24965867 Distribution of peptidergic populations in the human dentate gyrus (somatostatin [SOM-28, SOM-12] and neuropeptide Y [NPY]) during postnatal development.
24602981 No somatostatin promoter hypermethylation was detected in the Alzheimer neocortex.
24415445 Hemostatic effects and safety does not differ significantly between somatostatin and octreotide as adjuvants to endoscopic treatment in patients with acute gastroesophageal variceal bleeding.
23825418 Somatostatin neurons contribute differently to spatial integration.
23312523 Somatostatin interneurons-mediated disinhibition represents an important circuit mechanism for cortical information processing.
More...

AA Sequence

MLSCRLQCALAALSIVLALGCVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEP      1 - 70
EDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC                             71 - 116
//

Text Mined References (89)

PMID Year Title
25881116 2015 Hypermethylation of BDNF and SST Genes in the Orbital Frontal Cortex of Older Individuals: A Putative Mechanism for Declining Gene Expression with Age.
25734919 2015 Aberrant methylation inactivates somatostatin and somatostatin receptor type 1 in head and neck squamous cell carcinoma.
25723531 2015 Promoter hypermethylation-related reduced somatostatin production promotes uncontrolled cell proliferation in colorectal cancer.
25406263 2015 Somatostatin and insulin mediate glucose-inhibited glucagon secretion in the pancreatic ?-cell by lowering cAMP.
25156131 2014 The clinical significance of somatostatin in pancreatic diseases.
24965867 2014 Distribution of peptidergic populations in the human dentate gyrus (somatostatin [SOM-28, SOM-12] and neuropeptide Y [NPY]) during postnatal development.
24602981 2014 Methylation analysis of SST and SSTR4 promoters in the neocortex of Alzheimer's disease patients.
24415445 2014 Lack of difference among terlipressin, somatostatin, and octreotide in the control of acute gastroesophageal variceal hemorrhage.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23825418 2013 Contrast dependence and differential contributions from somatostatin- and parvalbumin-expressing neurons to spatial integration in mouse V1.
More...