Property Summary

NCBI Gene PubMed Count 45
Grant Count 22
R01 Count 8
Funding $2,313,485.49
PubMed Score 135.00
PubTator Score 31.34

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
22944692 HIV-1 Rev interacting protein, ribosomal protein S3A (RPS3A), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
22174317 HIV-1 Rev interacting protein, ribosomal protein S3A (RPS3A), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
21857917 Results suggest that RPS3a, via extra-ribosomal chaperoning function for HBx, contributes to virally induced oncogenesis by enhancing HBx-induced NF-kappaB signaling pathway.
16385451 Variants in the RPS3A homologue are associated with late-onset Alzheimer disease and implicate this gene, adjacent genes, or other functional variants (e.g., noncoding RNAs) in the pathogenesis of this disorder.
15889794 RPS3A expression in patients with squamous cell lung cancer increased by 70% which makes it a highly informative marker of squamous cell lung cancer
12463423 regulation of ribosomal S3a gene expression during cyclic amp induced neuroendocrine differentiation of LNCaP cells

AA Sequence

MAVGKNKRLTKGGKKGAKKKVVDPFSKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVS      1 - 70
LADLQNDEVAFRKFKLITEDVQGKNCLTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCV     71 - 140
GFTKKRNNQIRKTSYAQHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEKACQSIYPLHDV    141 - 210
FVRKVKMLKKPKFELGKLMELHGEGSSSGKATGDETGAKVERADGYEPPVQESV                    211 - 264
//

Text Mined References (62)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
More...