Property Summary

NCBI Gene PubMed Count 117
PubMed Score 110.61
PubTator Score 789.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (12)

Disease log2 FC p
acute quadriplegic myopathy 1.041 2.6e-04
astrocytoma 1.200 1.1e-02
Crohn's disease -1.025 3.7e-04
dermatomyositis 1.300 2.1e-03
esophageal adenocarcinoma -1.100 1.8e-02
juvenile dermatomyositis 1.401 5.9e-13
non primary Sjogren syndrome sicca 1.200 1.1e-02
osteosarcoma 1.072 9.8e-04
ovarian cancer -1.900 2.2e-07
psoriasis -2.000 7.7e-05
subependymal giant cell astrocytoma -1.323 8.1e-03
ulcerative colitis -1.108 8.3e-03

Gene RIF (38)

AA Sequence

MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEY      1 - 70
IQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDNSLYTNAKGSTISAFDGGSDS     71 - 140
SSESEPEEPQSRKKLRMEAS                                                      141 - 160
//

Text Mined References (124)

PMID Year Title