Property Summary

NCBI Gene PubMed Count 33
Grant Count 161
R01 Count 121
Funding $13,486,510.14
PubMed Score 178.59
PubTator Score 25.68

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P61225 P17964 Q96EG5 Q9CXG0
Symbols

Gene

PDB

1N4P   1N4Q   1N4R  

 GO Function (2)

Gene RIF (14)

PMID Text
26308105 Expression and DNA methylation status of the Rap2B gene in human bronchial epithelial cells treated by cigarette smoke condensate
25762091 Rap2B itself is not necessary for p53-dependent cell cycle arrest.
25663460 Our collective findings provide preliminary evidence that miR-342-3p acts as a tumor suppressor in small cell lung cancer through repression of RAP2B.
24951956 Data indicate that rap GTP-binding protein Rap2B expression is significantly increased in suprarenal epithelioma and Rap2B can promote the cell migration and invasion abilities, suggesting a target for the treatment of suprarenal epithelioma.
24586238 Prostaglandin E2-mediated HIV-1 inhibition requires the EPAC/RAP/RhoA signaling pathway by downregulation of HIV-1 CA production
23535297 Rap2b is a conserved p53-activated gene that counters p53-mediated apoptosis after DNA damage.
23535297 Rap2b mediates the pro-survival function of p53 upon DNA damage.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20471030 This protein has been found differentially expressed in thalami from patients with schizophrenia.
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDL      1 - 70
YIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDLEGEREVSYGEGKALAEEWSC     71 - 140
PFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSACVIL                               141 - 183
//

Text Mined References (37)

PMID Year Title
26308105 2015 Expression and DNA methylation status of the Rap2B gene in human bronchial epithelial cells treated by cigarette smoke condensate.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25762091 2015 p53 target gene Rap2B regulates the cytoskeleton and inhibits cell spreading.
25663460 2015 miR-342-3p targets RAP2B to suppress proliferation and invasion of non-small cell lung cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
24951956 2014 Rap2B promotes migration and invasion of human suprarenal epithelioma.
23885123 2013 JAM-A associates with ZO-2, afadin, and PDZ-GEF1 to activate Rap2c and regulate epithelial barrier function.
23535297 2013 Rap2b, a novel p53 target, regulates p53-mediated pro-survival function.
22797597 2012 Rap2A links intestinal cell polarity to brush border formation.
21269460 2011 Initial characterization of the human central proteome.
More...