Property Summary

NCBI Gene PubMed Count 38
PubMed Score 181.07
PubTator Score 25.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Gene RIF (19)

AA Sequence

MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDL      1 - 70
YIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDLEGEREVSYGEGKALAEEWSC     71 - 140
PFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSACVIL                               141 - 183
//

Text Mined References (42)

PMID Year Title