Property Summary

NCBI Gene PubMed Count 65
Grant Count 67
R01 Count 39
Funding $9,128,236.34
PubMed Score 397.47
PubTator Score 68.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma -1.100 0.000

Synonym

Accession P61224 B2R5Z2 B4DQI8 B4DW74 B4DW94 P09526 Q502X3 Q5TZR4 Q6DCA1 Q6LES0
Symbols K-REV
RAL1B

Gene

PDB

4HDQ   3BRW   3CF6   4DXA   4HDO   4M8N   4MGI   4MGK   4MGY   4MGZ   4MH0  

Gene RIF (31)

PMID Text
26329876 The protein expression of RAP1B and HIF-1 alpha contributed to gastric cancer malignant behavior and poor prognosis.
26209110 Cholera toxin and beta-adrenergic receptor activation phosphorylate Rap1B and inhibit its prenylation and membrane localization.
25569036 Glucocorticoids mediate induction of microRNA-708 to suppress ovarian cancer metastasis through targeting Rap1B.
24790136 Rap1b in both smooth muscle and endothelium plays a key role in maintaining blood pressure by controlling normal vascular tone.
24697700 Hepatitis B virus down-regulated miR-101-3p expression, which resulted in up-regulation of Rap1b, and down-regulation of miR-101-3p or up-regulation of Rap1b promoted proliferation and migration of hepatocellular carcinoma cells
24586238 Prostaglandin E2-mediated HIV-1 inhibition requires the EPAC/RAP/RhoA signaling pathway by downregulation of HIV-1 CA production
24573637 TMZ as a standard chemotherapeutic agent for GBM inhibits the Rap1B expression and actin cytoskeleton remodeling to exert its cell killing by upregulating miR-181a/b/c/d subunits
24353183 findings show Rap1b expression decreased significantly in tubules of renal biopsies from patients with diabetic nephropathy (DN); findings indicate Rap1b ameliorates tubular injury and slows progression of DN by modulation of mitochondrial dysfunction via C/EBP-beta-PGC-1alpha signaling
23946483 optimal cell migration is associated with cycles of Rap1 activation, membrane egress, and inactivation, and requires the regulated phosphorylation of Rap1 by PKA
23716716 High concentrations of extracellular adenosine in the tumor microenvironment can chronically activate A2B receptors to suppress Rap1B prenylation and signaling at the cell membrane, resulting in reduced cell-cell contact and promoting cell scattering.
More...

AA Sequence

MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDL      1 - 70
YMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNN     71 - 140
CAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSSCQLL                              141 - 184
//

Text Mined References (70)

PMID Year Title
26329876 2015 Expression of RAP1B is associated with poor prognosis and promotes an aggressive phenotype in gastric cancer.
26209110 2015 ?-Adrenergic receptors suppress Rap1B prenylation and promote the metastatic phenotype in breast cancer cells.
25569036 2015 Glucocorticoids mediate induction of microRNA-708 to suppress ovarian cancer metastasis through targeting Rap1B.
25416956 2014 A proteome-scale map of the human interactome network.
24790136 2014 Rap1b in smooth muscle and endothelium is required for maintenance of vascular tone and normal blood pressure.
24697700 2014 Functional analysis of miR-101-3p and Rap1b involved in hepatitis B virus-related hepatocellular carcinoma pathogenesis.
24573637 2014 miR-181 subunits enhance the chemosensitivity of temozolomide by Rap1B-mediated cytoskeleton remodeling in glioblastoma cells.
24353183 2014 Rap1 ameliorates renal tubular injury in diabetic nephropathy.
23946483 2013 Protein kinase A-dependent phosphorylation of Rap1 regulates its membrane localization and cell migration.
23716716 2013 An adenosine-mediated signaling pathway suppresses prenylation of the GTPase Rap1B and promotes cell scattering.
More...