Property Summary

NCBI Gene PubMed Count 68
PubMed Score 417.64
PubTator Score 68.49

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma -1.100 7.9e-09

Gene RIF (33)

AA Sequence

MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDL      1 - 70
YMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNN     71 - 140
CAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSSCQLL                              141 - 184
//

Text Mined References (73)

PMID Year Title