Property Summary

NCBI Gene PubMed Count 43
PubMed Score 163.90
PubTator Score 102.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Colorectal Neoplasms 243 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Hypertrophic cardiomyopathy 20 12 3.468 1.7

Expression

  Differential Expression (6)

Disease log2 FC p
acute quadriplegic myopathy 1.058 4.3e-06
diabetes mellitus -1.300 6.3e-03
lung cancer 1.600 3.6e-04
medulloblastoma, large-cell 1.100 4.6e-04
Multiple myeloma 1.374 4.7e-04
ovarian cancer 1.600 1.6e-03

Gene RIF (47)

AA Sequence

MADKLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCGICIKKCPFGAL      1 - 70
SIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTALKILAGKQKPNLGKYDDPPDW     71 - 140
QEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKAAKGTVGSILDRKDETKTQAIVCQQLDLTHLK    141 - 210
ERNVEDLSGGELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITIRSLINPDRYIIVVEHDLSVLD    211 - 280
YLSDFICCLYGVPSAYGVVTMPFSVREGINIFLDGYVPTENLRFRDASLVFKVAETANEEEVKKMCMYKY    281 - 350
PGMKKKMGEFELAIVAGEFTDSEIMVMLGENGTGKTTFIRMLAGRLKPDEGGEVPVLNVSYKPQKISPKS    351 - 420
TGSVRQLLHEKIRDAYTHPQFVTDVMKPLQIENIIDQEVQTLSGGELQRVALALCLGKPADVYLIDEPSA    421 - 490
YLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIMATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLS    491 - 560
QLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD                                   561 - 599
//

Text Mined References (47)

PMID Year Title