Property Summary

NCBI Gene PubMed Count 39
Grant Count 43
R01 Count 34
Funding $4,902,983.21
PubMed Score 151.85
PubTator Score 102.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.374 0.000
medulloblastoma, large-cell 1.100 0.000
acute quadriplegic myopathy 1.058 0.000
lung cancer 1.600 0.000
diabetes mellitus -1.300 0.006
ovarian cancer 1.600 0.002

Gene RIF (52)

PMID Text
26617714 miR-299-3p promotes the sensibility of lung cancer to doxorubicin through suppression of ABCE1, at least partly. Therefore, the disordered decreased of miR-299-3p and resulting ABCE1 up-expression may contribute to chemoresistance of lung cancer
26600528 Expression of the ABCE1-silencing gene, transfected by electrotransfer, could inhibit the proliferation, invasion, and migration of thyroid cancer cells.
25815591 ABCE1 is closely associated with cell proliferation, invasion and migration in esophageal cancer and silencing the ABCE1 gene by electroporation can significantly reduce the proliferation, invasion and migration capacity
25749978 The nucleocapsid (NC) domain of Gag is critical for interaction with endogenous ABCE1 in primate cells; basic residues in NC are critical for the Gag-ABCE1 interaction, while the cysteine and histidine residues in the zinc fingers are dispensable
25744244 Downregulation of ABCE1 via siRNA affects the sensitivity of lung cancer cells against chemotherapeutic agents.
25659154 ABCE1 is able to suppress RNA silencing in Nicotiana benthamiana plants, in mammalian HEK293 cells and in the worm Caenorhabditis elegans.
25337191 ABCE1 is closely connected with the pathogenesis and development of oral cancer, which acts through the cellular pathways of 2-5A/RNase L.
25066606 The nucleocapsid (NC) domain of Gag is critical for interaction with endogenous ABCE1 in primate cells; basic residues in NC are critical for the Gag-ABCE1 interaction, while the cysteine and histidine residues in the zinc fingers are dispensable
25066606 The nucleocapsid (NC) domain of Gag is critical for interaction with endogenous ABCE1 in primate cells; basic residues in NC are critical for the Gag-ABCE1 interaction, while the cysteine and histidine residues in the zinc fingers are dispensable
24623418 The nucleocapsid (NC) domain of Gag is critical for interaction with endogenous ABCE1 in primate cells; basic residues in NC are critical for the Gag-ABCE1 interaction, while the cysteine and histidine residues in the zinc fingers are dispensable
More...

AA Sequence

MADKLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCGICIKKCPFGAL      1 - 70
SIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTALKILAGKQKPNLGKYDDPPDW     71 - 140
QEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKAAKGTVGSILDRKDETKTQAIVCQQLDLTHLK    141 - 210
ERNVEDLSGGELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITIRSLINPDRYIIVVEHDLSVLD    211 - 280
YLSDFICCLYGVPSAYGVVTMPFSVREGINIFLDGYVPTENLRFRDASLVFKVAETANEEEVKKMCMYKY    281 - 350
PGMKKKMGEFELAIVAGEFTDSEIMVMLGENGTGKTTFIRMLAGRLKPDEGGEVPVLNVSYKPQKISPKS    351 - 420
TGSVRQLLHEKIRDAYTHPQFVTDVMKPLQIENIIDQEVQTLSGGELQRVALALCLGKPADVYLIDEPSA    421 - 490
YLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIMATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLS    491 - 560
QLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD                                   561 - 599
//

Text Mined References (43)

PMID Year Title
26617714 2015 MicroRNA-299-3p promotes the sensibility of lung cancer to doxorubicin through directly targeting ABCE1.
26600528 2015 Effect of ABCE1-silencing gene, transfected by electrotransfer, on the proliferation, invasion, and migration of human thyroid carcinoma SW579 cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25944354 2015 Host interactions of Chandipura virus matrix protein.
25815591 2015 Effects of silencing the ATP-binding cassette protein E1 gene by electroporation on the proliferation and migration of EC109 human esophageal cancer cells.
25744244 2015 Downregulation of ABCE1 via siRNA affects the sensitivity of A549 cells against chemotherapeutic agents.
25659154 2015 ABCE1 is a highly conserved RNA silencing suppressor.
25337191 2014 Knock-down of ABCE1 gene induces G1/S arrest in human oral cancer cells.
24551278 2014 Depleting ABCE1 expression induces apoptosis and inhibits the ability of proliferation and migration of human esophageal carcinoma cells.
23266104 2013 Tying up loose ends: ribosome recycling in eukaryotes and archaea.
More...