Property Summary

NCBI Gene PubMed Count 34
PubMed Score 168.31
PubTator Score 32.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma -1.400 1.2e-02
astrocytic glioma -1.100 6.0e-03
Astrocytoma, Pilocytic -1.500 5.3e-04
atypical teratoid / rhabdoid tumor -2.200 2.9e-07
Breast cancer 1.200 2.6e-13
cutaneous lupus erythematosus 1.200 2.8e-03
diabetes mellitus 1.200 8.0e-03
Duchenne muscular dystrophy 1.082 5.0e-06
ependymoma -1.100 3.1e-02
glioblastoma -1.300 3.2e-05
group 3 medulloblastoma -1.400 1.9e-03
intraductal papillary-mucinous adenoma (... -1.200 2.1e-04
juvenile dermatomyositis 1.043 2.8e-09
medulloblastoma, large-cell -1.900 8.4e-04
Multiple myeloma 1.342 1.4e-03
oligodendroglioma -1.300 2.2e-20
osteosarcoma 2.453 4.7e-07
ovarian cancer -1.100 4.3e-04
Pick disease -1.200 7.8e-04
primitive neuroectodermal tumor -2.100 8.7e-05
Subcutaneous panniculitis-like T-cell ly... 1.100 3.6e-03

Gene RIF (9)

AA Sequence

MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGG      1 - 70
QDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEIT     71 - 140
DKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK                                 141 - 181
//

Text Mined References (37)

PMID Year Title