Property Summary

NCBI Gene PubMed Count 33
PubMed Score 170.96
PubTator Score 32.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
oligodendroglioma 2849 2.1619732592215E-20
Breast cancer 3099 2.55192497624701E-13
juvenile dermatomyositis 1189 2.84106724695281E-9
ovarian cancer 8492 2.09121770054128E-7
atypical teratoid / rhabdoid tumor 4369 2.93773139547915E-7
posterior fossa group B ependymoma 1530 4.55843215867932E-7
medulloblastoma 1524 4.59631210044197E-7
osteosarcoma 7933 4.65880949124119E-7
glioblastoma 5572 2.67365036400636E-6
Duchenne muscular dystrophy 602 5.01572127490891E-6
primitive neuroectodermal tumor 3031 8.65022059650244E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 2.12058542745176E-4
medulloblastoma, large-cell 6234 2.35411588898453E-4
pediatric high grade glioma 2712 2.46235447121704E-4
astrocytoma 1493 5.02587835892333E-4
Pick disease 1893 7.76262177506276E-4
Multiple myeloma 1328 0.00142401263946921
pilocytic astrocytoma 3086 0.00194415236971846
cutaneous lupus erythematosus 1056 0.00284773072913066
Subcutaneous panniculitis-like T-cell lymphoma 16 0.00361229379144181
diabetes mellitus 1663 0.00801024916543656

Expression

Synonym

Accession P61204 A8K6G8 B7ZB63 P16587
Symbols

Gene

  Ortholog (5)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid

Gene RIF (8)

PMID Text
26330566 observations indicate that Arf1 and Arf3 as well as Arf6 play important roles in cytokinesis.
26067373 activated ARF3 is associated with Unc93B1 and TLR9, suggesting that ARF3 conducts TLR9 trafficking by forming the TLR9-Unc93B1-ARF3 complex.
23783033 ARF1+ARF3 are required for integrity of recycling endosomes but are involved in distinct transport pathways: they are required for the transferrin recycling pathway from endosomes to the plasma membrane.
22971977 ARF1 and ARF3 are redundantly required for the integrity of recycling endosomes
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20357002 These results suggest that Arf3 plays a unique function at the trans-Golgi network that likely involves recruitment by a specific receptor.
19913121 Observational study of gene-disease association. (HuGE Navigator)
12135740 expression and subcellular redistribution by heregulin

AA Sequence

MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGG      1 - 70
QDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEIT     71 - 140
DKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK                                 141 - 181
//

Text Mined References (36)

PMID Year Title
26330566 2016 Class I Arfs (Arf1 and Arf3) and Arf6 are localized to the Flemming body and play important roles in cytokinesis.
26067373 2015 ADP-Ribosylation Factor 3 Mediates Cytidine-Phosphate-Guanosine Oligodeoxynucleotide-Induced Responses by Regulating Toll-Like Receptor 9 Trafficking.
24768165 2014 WLS retrograde transport to the endoplasmic reticulum during Wnt secretion.
23783033 2013 ARF1 and ARF4 regulate recycling endosomal morphology and retrograde transport from endosomes to the Golgi apparatus.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22971977 2012 ARF1 and ARF3 are required for the integrity of recycling endosomes and the recycling pathway.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20357002 2010 Arf3 is activated uniquely at the trans-Golgi network by brefeldin A-inhibited guanine nucleotide exchange factors.
More...