Property Summary

NCBI Gene PubMed Count 47
PubMed Score 9.06
PubTator Score 363.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
hereditary spastic paraplegia -1.091 7.6e-03
Multiple myeloma 2.366 2.6e-04
ovarian cancer -1.700 2.1e-05
tuberculosis and treatment for 6 months 1.400 8.9e-06
Waldenstrons macroglobulinemia 1.148 3.4e-02

Gene RIF (14)

AA Sequence

MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFK      1 - 70
ALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALK     71 - 140
DAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKN    141 - 210
NKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYL    211 - 280
VLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEEL    281 - 350
LRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGAR    351 - 420
YTALDKWTNQLNSLNQAVVSKLA                                                   421 - 443
//

Text Mined References (50)

PMID Year Title