Property Summary

NCBI Gene PubMed Count 42
Grant Count 1
Funding $120,800
PubMed Score 7.80
PubTator Score 363.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.148 0.034
Multiple myeloma 2.366 0.000
hereditary spastic paraplegia -1.091 0.008
tuberculosis and treatment for 6 months 1.400 0.000
ovarian cancer -1.700 0.000

Synonym

Accession P61201 O88950 Q15647 Q6FGP4 Q9BY54 Q9R249 Q9UNI2 Q9UNQ5 SGN2
Symbols CSN2
SGN2
ALIEN
TRIP15

Gene

 Grant Application (1)

PDB

4D10   4D18   4WSN  

Gene RIF (12)

PMID Text
23441852 p300 binds to Alien alpha by pull down (View interaction) Alien alpha physically interacts with CBP by two hybrid
22190034 HIV-1 Vpr is identified to have a physical interaction with COP9 constitutive photomorphogenic homolog subunit 2 (COPS2; CSN2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
19535905 A subunit of the COP9 signalosome interacted physically with the anaphase-promoting complex and showed a genetic instability of cells.
19400951 CSN2 knockdown cells underwent non-apoptotic cell death.
18174916 Alien seems to modulate nucleosome assembly activity. This suggests that Alien is acting on chromatin not only through recruitment of histone-modifying activities, but also through enhancing nucleosome assembly.
17968325 CSN2 gene was identified in the genome-wide loss-of-function genetic screen as putative tumor suppressor located at 15q21.2.
17929852 the interaction between Alien and the tumor suppressors p33ING1 and p33ING2 reveals a novel cellular protein network
17570542 Alien inhibits E2F1 gene expression and cell proliferation.
17438371 Protein interactions of Alien involving nucleophosmin, ERCC3, TRIP11, as well as CRSP3.
17339334 Data show that Alien binds in vivo and in vitro to NAP1 and modulates its activity by enhancing NAP1-mediated nucleosome assembly on DNA.
More...

AA Sequence

MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFK      1 - 70
ALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALK     71 - 140
DAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKN    141 - 210
NKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYL    211 - 280
VLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEEL    281 - 350
LRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGAR    351 - 420
YTALDKWTNQLNSLNQAVVSKLA                                                   421 - 443
//

Text Mined References (44)

PMID Year Title
24421388 2014 Dynamic regulation of the COP9 signalosome in response to DNA damage.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23441852 2013 The corepressor activity of Alien is controlled by CREB-binding protein/p300.
21911577 2011 A physical interaction network of dengue virus and human proteins.
21269460 2011 Initial characterization of the human central proteome.
19535905 2009 Regulation of the anaphase-promoting complex by the COP9 signalosome.
19400951 2009 Analysis of the role of COP9 Signalosome (CSN) subunits in K562; the first link between CSN and autophagy.
19141280 2009 Symmetrical modularity of the COP9 signalosome complex suggests its multifunctionality.
18850735 2008 Characterization of the human COP9 signalosome complex using affinity purification and mass spectrometry.
18174916 2007 The coregulator Alien.
More...