Property Summary

NCBI Gene PubMed Count 18
PubMed Score 2.02
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma 1.200 1.6e-06
atypical teratoid / rhabdoid tumor 1.500 1.3e-08
glioblastoma 1.100 1.4e-10
lung cancer 1.100 1.8e-03
medulloblastoma, large-cell 1.300 1.2e-05
osteosarcoma 1.428 4.8e-05
ovarian cancer -1.200 4.4e-05
primitive neuroectodermal tumor 1.200 9.7e-06
psoriasis 2.600 4.5e-05
sonic hedgehog group medulloblastoma 1.400 3.5e-10

Gene RIF (4)

AA Sequence

MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVASLFMGFGVLF      1 - 70
LLLWVGIYV                                                                  71 - 79
//

Text Mined References (24)

PMID Year Title