Property Summary

NCBI Gene PubMed Count 38
PubMed Score 6.34
PubTator Score 45.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
diabetes mellitus -1.400 1.4e-03
osteosarcoma -2.941 1.4e-08
ovarian cancer 1.100 3.6e-04
posterior fossa group B ependymoma -1.100 9.3e-13
psoriasis -2.100 1.8e-05

 GO Function (1)

Gene RIF (2)

AA Sequence

MESYDVIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLS      1 - 70
IRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNVPALFIS     71 - 140
MQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHSSSE    141 - 210
FEIVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLV    211 - 280
FAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASL    281 - 350
DTFKKMWVSKKEYEEDGARSIHRKTF                                                351 - 376
//

Text Mined References (43)

PMID Year Title