Property Summary

NCBI Gene PubMed Count 34
PubMed Score 6.08
PubTator Score 45.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -2.100 0.000
osteosarcoma -2.941 0.000
diabetes mellitus -1.400 0.001
posterior fossa group B ependymoma -1.100 0.000
ovarian cancer 1.100 0.000

 GO Function (1)

Gene RIF (2)

PMID Text
18303113 point mutation observed by transcriptome sequencing of malignant pleural mesothelioma tumors
12871323 ARP1 interacted with two regions of the FVII 5' flanking region, the hepatic nuclear factor 4 binding region and the nuclear hormone response region, indicating a role for ARP1 in transcriptional modulation of the FVII gene.

AA Sequence

MESYDVIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLS      1 - 70
IRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNVPALFIS     71 - 140
MQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHSSSE    141 - 210
FEIVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLV    211 - 280
FAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASL    281 - 350
DTFKKMWVSKKEYEEDGARSIHRKTF                                                351 - 376
//

Text Mined References (39)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
More...